Product Name : Phospho-KV3.1 (Ser503) Polyclonal AntibodySpecies Reactivity: Hamster, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Affinity chromatographyStorage buffer: 0.01M HEPES, pH…
Product Name : Phospho-KV2.1 (Ser805) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4, with…
Product Name : Phospho-KV2.1 (KCNB1) (Ser805) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : 2-Methylhexanoic acid-d3Description:2-Methylhexanoic acid-d3 is the deuterium labeled 2-Methylhexanoic acid. 2-Methylhexanoic acid is a nematicide.CAS: 2570271-31-5Molecular Weight:133.20Formula: C7H14O2Chemical Name: Smiles : C()()C(CCCC)C(O)=OInChiKey: CVKMFSAVYPAZTQ-BMSJAHLVSA-NInChi : InChI=1S/C7H14O2/c1-3-4-5-6(2)7(8)9/h6H,3-5H2,1-2H3,(H,8,9)/i2D3Purity: ≥98% (or refer…
Product Name : Kaempferol-7,4'-dimethyl etherDescription:Kaempferol-7, 4'-dimethyl ether is found in Boesenbergia longiflora.CAS: 15486-33-6Molecular Weight:314.29Formula: C17H14O6Chemical Name: 3, 5-Dihydroxy-7-methoxy-2-(4-methoxyphenyl)-4H-chromen-4-oneSmiles : COC1C=CC(=CC=1)C1OC2=CC(=CC(O)=C2C(=O)C=1O)OCInChiKey: KZBAXKKOXPLOBX-UHFFFAOYSA-NInChi : InChI=1S/C17H14O6/c1-21-10-5-3-9(4-6-10)17-16(20)15(19)14-12(18)7-11(22-2)8-13(14)23-17/h3-8,18,20H,1-2H3Purity: ≥98% (or refer to the Certificate of…
Product Name : Phospho-KV1.1 (KCNA1) (Ser446) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Phospho-KSR2 (Thr497) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-KSR1 (Thr425) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : AtiratecanDescription:Atiratecan (TP300) is a prodrug of camptothecin analog CH0793076 (HY-107096). Atiratecan does not inhibit acetylcholinesterase (AChE) activities. Atiratecan shows antitumor activity against both breast cancer resistance protein…
Product Name : Phospho-KSR1 (Ser392) Recombinant Rabbit Monoclonal Antibody (KSR1S392-3A4)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgG, kappaClass:Recombinant MonoclonalType : AntibodyClone: KSR1S392-3A4Conjugate : Unconjugated View additional formats FITC PEForm: LiquidConcentration…
Product Name : Phospho-KLF4 (Ser254) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-KSR1 (Ser392) Polyclonal AntibodySpecies Reactivity: Human, Mouse, Non-human primate, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer:…
Product Name : BC-LI-0186Description:BC-LI-0186 is a potent and selective inhibitor of Leucyl-tRNA synthetase (LRS; LeuRS) and Ras-related GTP-binding protein D (RagD) interaction (IC50=46.11 nM). BC-LI-0186 competitively binds to the RagD…
Product Name : Norethisterone enanthateDescription:Norethisterone enanthate is a long-acting parenteral progestogen. Norethisterone enanthate is orally active.CAS: 3836-23-5Molecular Weight:410.59Formula: C27H38O3Chemical Name: (1R,3aS,3bR,9aR,9bS,11aS)-1-ethynyl-11a-methyl-7-oxo-1H,2H,3H,3aH,3bH,4H,5H,7H,8H,9H,9aH,9bH,10H,11H,11aH-cyclopentaphenanthren-1-yl heptanoateSmiles : C12CC34CCC(=O)C=C4CC31CC2(C#C)OC(=O)CCCCCCInChiKey: APTGJECXMIKIET-WOSSHHRXSA-NInChi : InChI=1S/C27H38O3/c1-4-6-7-8-9-25(29)30-27(5-2)17-15-24-23-12-10-19-18-20(28)11-13-21(19)22(23)14-16-26(24,27)3/h2,18,21-24H,4,6-17H2,1,3H3/t21-,22+,23+,24-,26-,27-/m0/s1Purity: ≥98% (or refer…
Product Name : Phospho-KISS1R (Ser368) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-KIZUNA (Thr379) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH 7.4, with…
Product Name : Phospho-KIRREL (Tyr737, Tyr738) Polyclonal Antibody, FITCSpecies Reactivity: Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : FITCForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary…
Product Name : CHK1-IN-3Description:CHK1-IN-3 is a Checkpoint Kinase 1 (CHK1) inhibitor with an IC50 of 0.4 nM.CAS: 2097252-39-4Molecular Weight:405.46Formula: C20H23N9OChemical Name: 5-{amino}-3-pyridine-2-carbonitrileSmiles : CNC1=NC(NC2=CC(O3CNCCC3)=C(C#N)N=C2)=NC=C1C1C=NN(C)C=1InChiKey: SLCNIAWQMQCAFR-OAHLLOKOSA-NInChi : InChI=1S/C20H23N9O/c1-22-19-16(13-8-26-29(2)12-13)11-25-20(28-19)27-14-6-18(17(7-21)24-9-14)30-15-4-3-5-23-10-15/h6,8-9,11-12,15,23H,3-5,10H2,1-2H3,(H2,22,25,27,28)/t15-/m1/s1Purity: ≥98% (or refer…
Product Name : NSC117079Description:NSC117079 is a novel PHLPP inhibitor.CAS: 500363-63-3Molecular Weight:473.48Formula: C20H15N3O7S2Chemical Name: 1-amino-9,10-dioxo-4--9,10-dihydroanthracene-2-sulfonic acidSmiles : NS(=O)(=O)C1=CC(=CC=C1)NC1=CC(=C(N)C2=C1C(=O)C1=CC=CC=C1C2=O)S(O)(=O)=OInChiKey: LHSBZAWDPSTOEY-UHFFFAOYSA-NInChi : InChI=1S/C20H15N3O7S2/c21-18-15(32(28,29)30)9-14(23-10-4-3-5-11(8-10)31(22,26)27)16-17(18)20(25)13-7-2-1-6-12(13)19(16)24/h1-9,23H,21H2,(H2,22,26,27)(H,28,29,30)Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped…
Product Name : Phospho-KIRREL (Tyr737, Tyr738) Polyclonal Antibody, BiotinSpecies Reactivity: Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary…
Product Name : Phospho-KIR5.1 (Ser416) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-KIRREL (Tyr737, Tyr738) Polyclonal AntibodySpecies Reactivity: Chicken, Human, Mouse, Rat, ZebrafishHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage…
Product Name : TP3011Description:TP3011 (CH0793011) is an active metabolite of CH-0793076 and is a potent topoisomerase I inhibitor equipotent as SN38. TP3011 is against cancer cell lines growth with IC50s…
Product Name : Phospho-KIF20A (Ser528) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Phospho-KIF11 (Thr926) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-KIF1C (Ser1092) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Bromoacetamide-PEG3-C1-acidDescription:Bromoacetamide-PEG3-C1-acid is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 173323-22-3Molecular Weight:328.16Formula: C10H18BrNO6Chemical Name: 2-(2-{2-ethoxy}ethoxy)acetic acidSmiles : OC(=O)COCCOCCOCCNC(=O)CBrInChiKey: YTQSICXMSXKITM-UHFFFAOYSA-NInChi : InChI=1S/C10H18BrNO6/c11-7-9(13)12-1-2-16-3-4-17-5-6-18-8-10(14)15/h1-8H2,(H,12,13)(H,14,15)Purity: ≥98%…
Product Name : Phospho-KCNJ1 (Ser44) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-KChIP3 (Ser63) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-KHK isoform A (Ser80) Polyclonal AntibodySpecies Reactivity: Mouse, HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Boc-N-Amido-PEG2-C2-azideDescription:Boc-N-Amido-PEG2-C2-azide is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 950683-55-3Molecular Weight:274.32Formula: C11H22N4O4Chemical Name: tert-butyl N-{2-ethyl}carbamateSmiles : CC(C)(C)OC(=O)NCCOCCOCCN==InChiKey: MEZSEFQCLYODJG-UHFFFAOYSA-NInChi : InChI=1S/C11H22N4O4/c1-11(2,3)19-10(16)13-4-6-17-8-9-18-7-5-14-15-12/h4-9H2,1-3H3,(H,13,16)Purity: ≥98%…
Product Name : Phospho-KCNC1 (Ser503) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-KCNH2 (Ser1137) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-KCNA3 (Tyr135) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : DNP-PEG3-azideDescription:DNP-PEG3-azide is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.CAS: 951671-87-7Molecular Weight:384.34Formula: C14H20N6O7Chemical Name: 1-(12-azido-4,7,10-trioxa-1-azadodecan-1-yl)-2,4-dinitrobenzeneSmiles : ==NCCOCCOCCOCCNC1=CC=C(C=C1()=O)()=OInChiKey: FIAOTUUAWJBUBV-UHFFFAOYSA-NInChi : InChI=1S/C14H20N6O7/c15-18-17-4-6-26-8-10-27-9-7-25-5-3-16-13-2-1-12(19(21)22)11-14(13)20(23)24/h1-2,11,16H,3-10H2Purity: ≥98% (or…
Product Name : Phospho-KAT5 (Ser90) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-KCC2 (Ser940) Polyclonal AntibodySpecies Reactivity: Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : ~0.25 mg/mLPurification : Antigen Affinity ChromatographyStorage buffer: 10mM HEPES,…
Product Name : Phospho-KCC2 (Thr1007) Polyclonal AntibodySpecies Reactivity: Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : ~0.25 mg/mLPurification : Antigen Affinity ChromatographyStorage buffer: 10mM HEPES,…
Product Name : THP-PEG4-Pyrrolidine(N-Boc)-CH2OHDescription:THP-PEG4-Pyrrolidine(N-Boc)-CH2OH is a PEG-based PROTAC linker can be used in the synthesis of PROTAC K-Ras Degrader-1 (HY-129523).CAS: 2378261-80-2Molecular Weight:477.59Formula: C23H43NO9Chemical Name: tert-butyl (2S,4R)-2-(hydroxymethyl)-4-ethoxy}ethoxy)ethoxy]pyrrolidine-1-carboxylateSmiles : CC(C)(C)OC(=O)N1C(C1CO)OCCOCCOCCOCCOC1CCCCO1InChiKey: ZKEBNPQGNDNRDY-MCOCGALXSA-NInChi :…
Product Name : Ravuconazole-d4Description:Ravuconazole-d4 (BMS-207147-d4) is the deuterium labeled Ravuconazole. Ravuconazole (BMS-207147) is an orally available triazoleantifungle agent that potently inhibits a wide range of fungi.CAS: 1329499-27-5Molecular Weight:441.49Formula: C22H17F2N5OSChemical Name:…
Product Name : Phospho-KAT5 (Ser86) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: TBS with…
Product Name : Phospho-KAP-1 (Ser824) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: liquidConcentration : 0.20 mg/mLPurification : Antigen affinity chromatographyStorage buffer: TBS, pH…
Product Name : Phospho-KAP-1 (Ser824) Recombinant Rabbit Monoclonal Antibody (BL-246-7B5)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: BL-246-7B5Conjugate : UnconjugatedForm: liquidConcentration : 0.10 mg/mLPurification : purifiedStorage buffer:…
Product Name : W-2429Description:W-2429 is a non-narcotic analgesic agent.CAS: 37795-69-0Molecular Weight:188.18Formula: C10H8N2O2Chemical Name: 2H,3H,9H-oxazoloquinazolin-9-oneSmiles : O=C1C2=CC=CC=C2N=C2CCON21InChiKey: ZHIKRYZUZNUZFQ-UHFFFAOYSA-NInChi : InChI=1S/C10H8N2O2/c13-10-7-3-1-2-4-8(7)11-9-5-6-14-12(9)10/h1-4H,5-6H2Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under…
Product Name : Sibiricose A5Description:Sibiricose A5 is an oligosaccharide ester isolated from Polygalae Radix with potent antioxidant activity.CAS: 107912-97-0Molecular Weight:518.47Formula: C22H30O14Chemical Name: (2S,3S,4R,5R)-4-hydroxy-2,5-bis(hydroxymethyl)-2-{oxy}oxolan-3-yl (2E)-3-(4-hydroxy-3-methoxyphenyl)prop-2-enoateSmiles : COC1=CC(/C=C/C(=O)O2(O)(CO)O2(CO)O2O(CO)(O)(O)2O)=CC=C1OInChiKey: ZPEADZHVGOCGKH-YQTDNFGYSA-NInChi : InChI=1S/C22H30O14/c1-32-12-6-10(2-4-11(12)26)3-5-15(27)34-20-17(29)14(8-24)35-22(20,9-25)36-21-19(31)18(30)16(28)13(7-23)33-21/h2-6,13-14,16-21,23-26,28-31H,7-9H2,1H3/b5-3+/t13-,14-,16-,17-,18+,19-,20+,21-,22+/m1/s1Purity: ≥98%…
Product Name : Phospho-K-Ras (Ser89) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.87 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JunD (Ser259) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JunD (Ser255) Recombinant Rabbit Monoclonal Antibody (JJ08-21)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: JJ08-21Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein…
Product Name : Gymnoside IIIDescription:Gymnoside III is a glucosyloxybenzyl 2-isobutylmalate isolated from the tubers of Gymnadenia conopsea.CAS: 899430-03-6Molecular Weight:930.90Formula: C42H58O23Chemical Name: 1,4-bisoxy}phenyl)methyl] (2R)-2-{-3,4,5-trihydroxyoxan-2-yl]oxy}-2-(2-methylpropyl)butanedioateSmiles : CC(=O)OC1O(O(CC(=O)OCC2C=CC(=CC=2)O2O(CO)(O)(O)2O)(CC(C)C)C(=O)OCC2=CC=C(C=C2)O2O(CO)(O)(O)2O)(O)(O)1OInChiKey: MHVQDAOKYCPBQU-PCBDRJNGSA-NInChi : InChI=1S/C42H58O23/c1-19(2)12-42(65-40-37(55)34(52)31(49)27(64-40)18-57-20(3)45,41(56)59-17-22-6-10-24(11-7-22)61-39-36(54)33(51)30(48)26(15-44)63-39)13-28(46)58-16-21-4-8-23(9-5-21)60-38-35(53)32(50)29(47)25(14-43)62-38/h4-11,19,25-27,29-40,43-44,47-55H,12-18H2,1-3H3/t25-,26-,27-,29-,30-,31-,32+,33+,34+,35-,36-,37-,38-,39-,40+,42-/m1/s1Purity: ≥98% (or…
Product Name : N-FeruloylserotoninDescription:N-Feruloylserotonin, an antioxidative component and bioactive serotonin derivative, from the Seed of Carthamus tinctorius L., ameliorates atherosclerosis and distensibility of the aortic wall in Kurosawa and Kusanagi-hypercholesterolemic…
Product Name : Phospho-JunD (Ser255) Recombinant Rabbit Monoclonal Antibody (ARC1603)Species Reactivity: MouseHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: ARC1603Conjugate : UnconjugatedForm: LiquidConcentration : 2 mg/mLPurification : Affinity ChromatographyStorage buffer:…
Product Name : Phospho-JunD (Ser255) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : RabbitClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: Dulbecco's PBS, pH 7.4,…
Product Name : Phospho-JunD (Ser255) Recombinant Rabbit Monoclonal Antibody (5M8M4)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 5M8M4Conjugate : UnconjugatedForm: LiquidConcentration : 0.52 mg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : AladorianDescription:Aladorian (ARM036) is a benzothiazepine derivative, with anti-arrhythmia effect. Aladorian is used for the research of heart failure and catecholaminergic polymorphic ventricular tachycardia.CAS: 865433-00-7Molecular Weight:267.30Formula: C12H13NO4SChemical Name:…
Product Name : Phospho-JunB (Thr255) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JunB (Ser79) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Antigen affinity chromatographyStorage buffer: 25mM tris…
Product Name : Phospho-JunB (Thr102, Thr104) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : DaphyllosideDescription:Daphylloside is an iridoid isolated from the aerial parts of Galium verum.CAS: 14260-99-2Molecular Weight:446.40Formula: C19H26O12Chemical Name: methyl (1S,4aS,5S,7aS)-7--5-hydroxy-1-{oxy}-1H,4aH,5H,7aH-cyclopentapyran-4-carboxylateSmiles : CC(=O)OCC1=C(O)21(OC=C2C(=O)OC)O1O(CO)(O)(O)1OInChiKey: YSOBQIMODQOGKQ-HOZAMIDDSA-NInChi : InChI=1S/C19H26O12/c1-7(21)28-5-8-3-10(22)13-9(17(26)27-2)6-29-18(12(8)13)31-19-16(25)15(24)14(23)11(4-20)30-19/h3,6,10-16,18-20,22-25H,4-5H2,1-2H3/t10-,11+,12+,13-,14+,15-,16+,18-,19-/m0/s1Purity: ≥98% (or refer to…
Product Name : Giredestrant tartrateDescription:Giredestrant tartrate (GDC-9545 tartrate), a non-steroidal ER ligand, is an orally active and selective estrogen receptor (ER) antagonist. Giredestrant tartrate potently competes with estradiol for binding…
Product Name : Phospho-Jak3 (Tyr980, Tyr981) Recombinant Rabbit Monoclonal Antibody (JAK3Y980981-E10)Species Reactivity: HumanHost/Isotype : Rabbit / IgG, kappaClass:Recombinant MonoclonalType : AntibodyClone: JAK3Y980981-E10Conjugate : Unconjugated View additional formats APC FITC PEForm:…
Product Name : Phospho-JunB (Ser259) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : RabbitClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: Dulbecco's PBS, pH 7.4,…
Product Name : Phospho-Jak1 (Tyr1022, Tyr1023) Recombinant Rabbit Monoclonal Antibody (Jak1Y10221023-F11)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgG, kappaClass:Recombinant MonoclonalType : AntibodyClone: Jak1Y10221023-F11Conjugate : Unconjugated View additional formats APC FITC…
Product Name : PEG3-O-CH2COOHDescription:PEG3-O-CH2COOH (PROTAC Linker 8) is a PEG-based PROTAC linker can be used in the synthesis of SNIPERs.CAS: 51951-05-4Molecular Weight:208.21Formula: C8H16O6Chemical Name: 2-{2-ethoxy}acetic acidSmiles : OCCOCCOCCOCC(O)=OInChiKey: NUAYEVLSVMOUPE-UHFFFAOYSA-NInChi :…
Product Name : Phospho-Jak1 (Tyr1022, Tyr1023) Recombinant Rabbit Monoclonal Antibody (Jak1Y10221023-F11), FITCSpecies Reactivity: HumanHost/Isotype : Rabbit / IgG, kappaClass:Recombinant MonoclonalType : AntibodyClone: Jak1Y10221023-F11Conjugate : FITC View additional formats APC PE…
Product Name : Phospho-JUP (Tyr550) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-Jak1 (Tyr1022, Tyr1023) Recombinant Rabbit Monoclonal Antibody (Jak1Y10221023-F11), PESpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgG, kappaClass:Recombinant MonoclonalType : AntibodyClone: Jak1Y10221023-F11Conjugate : PE View additional formats APC…
Product Name : PinoresinolDescription:Pinoresinol is a lignol of plant origin serving for defense in a caterpillar. Pinoresinol drastically sensitizes cancer cells against TNF-related apoptosis-inducing ligand (TRAIL) -induced apoptosis.CAS: 487-36-5Molecular Weight:358.39Formula:…
Product Name : Phospho-JUN (Ser73) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 330 µg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-JNK1 (Thr183, Tyr185) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1.09 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JNK1 (Thr183, Tyr185) Recombinant Rabbit Monoclonal Antibody (HL1008)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: HL1008Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein…
Product Name : ZK 93426 hydrochlorideDescription:Product informationCAS: 1216792-30-1Molecular Weight:348.82Formula: C18H21ClN2O3Chemical Name: ethyl 4-methyl-5-(propan-2-yloxy)-9H-pyridoindole-3-carboxylate hydrochlorideSmiles : Cl.CC1C(=NC=C2NC3C=CC=C(OC(C)C)C=3C=12)C(=O)OCCInChiKey: RNQJDOYVHCISJU-UHFFFAOYSA-NInChi : InChI=1S/C18H20N2O3.ClH/c1-5-22-18(21)17-11(4)15-13(9-19-17)20-12-7-6-8-14(16(12)15)23-10(2)3;/h6-10,20H,5H2,1-4H3;1HPurity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under…
Product Name : Phospho-JNK1/JNK2 (Thr183, Tyr185) Monoclonal Antibody (R.532.8)Species Reactivity: Hamster, Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:MonoclonalType : AntibodyClone: R.532.8Conjugate : UnconjugatedForm: LiquidConcentration : 270 µg/mLPurification : Affinity chromatographyStorage…
Product Name : Phospho-JNK1 (Thr183) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JNK1/JNK2 (Thr183, Tyr185) Monoclonal Antibody (F.971.6)Species Reactivity: Fruit fly, Human, Mouse, Rat, YeastHost/Isotype : Rabbit / IgGClass:MonoclonalType : AntibodyClone: F.971.6Conjugate : UnconjugatedForm: LiquidConcentration : 293 µg/mLPurification :…
Product Name : Ivermectin B1a-d2Description:Product informationCAS: Molecular Weight:875.09Formula: C48H74O14Chemical Name: 6-(butan-2-yl)-21',24'-dihydroxy-12'-({5--4-methoxy-6-methyloxan-2-yl}oxy)-5,11',13',22'-tetramethyl-3',7',19'-trioxaspiropentacosane]-10',14',16',22'-tetraen-2'-oneSmiles : CCC(C)C1OC2(CC3CC(CC=C(C)C(OC4CC(OC)C(OC5CC(OC)C(O)C(C)O5)C(C)O4)C(C)C=CC=C4COC5C(O)C(C)=CC(C(=O)O3)C45O)O2)CCC1C |c:12,43,t:41|InChiKey: AZSNMRSAGSSBNP-JHJAMYNOSA-NInChi : InChI=1S/C48H74O14/c1-11-25(2)43-28(5)17-18-47(62-43)23-34-20-33(61-47)16-15-27(4)42(26(3)13-12-14-32-24-55-45-40(49)29(6)19-35(46(51)58-34)48(32,45)52)59-39-22-37(54-10)44(31(8)57-39)60-38-21-36(53-9)41(50)30(7)56-38/h12-15,19,25-26,28,30-31,33-45,49-50,52H,11,16-18,20-24H2,1-10H3/b13-12-,27-15-,32-14-Purity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient temperature…
Product Name : BMS-817378Description:Description: IC50: 1.7 nM/15 nM for Met/VEGFR2 The signaling pathway of the receptor tyrosine kinase MET and its ligand hepatocyte growth factor is important for cell growth,…
Product Name : Phospho-JNK1/JNK2 (Thr183, Tyr185) Monoclonal Antibody (E.665.10)Species Reactivity: Hamster, Human, Mouse, Rat, YeastHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: E.665.10Conjugate : UnconjugatedForm: LiquidConcentration : 591 µg/mLPurification : Affinity…
Product Name : Phospho-JNK1/JNK2 (Thr183, Tyr185) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's…
Product Name : Phospho-JNK1/JNK2 (Thr183, Tyr185) Recombinant Rabbit Monoclonal Antibody (D12H7L17)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: D12H7L17Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein…
Product Name : UK 78282 hydrochlorideDescription:Product informationCAS: 136647-02-4Molecular Weight:466.05Formula: C29H36ClNO2Chemical Name: 4--1-piperidine hydrochlorideSmiles : Cl.COC1=CC=C(CCCN2CCC(COC(C3=CC=CC=C3)C3=CC=CC=C3)CC2)C=C1InChiKey: ZZSQARULZYQMIG-UHFFFAOYSA-NInChi : InChI=1S/C29H35NO2.ClH/c1-31-28-16-14-24(15-17-28)9-8-20-30-21-18-25(19-22-30)23-32-29(26-10-4-2-5-11-26)27-12-6-3-7-13-27;/h2-7,10-17,25,29H,8-9,18-23H2,1H3;1HPurity: ≥98% (or refer to the Certificate of Analysis)Shipping Condition: Shipped under ambient…
Product Name : Phospho-JNK1/JNK2/JNK3 (Tyr185) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-JNK1/JNK2/JNK3 (Thr183, Tyr185) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Phospho-JNK1/JNK2/JNK3 (Thr183, Tyr185, Thr221, Tyr223) Recombinant Rabbit Monoclonal Antibody (6F10V6)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 6F10V6Conjugate : UnconjugatedForm: LiquidConcentration : 0.09…
Product Name : W-13 hydrochlorideDescription:W-13 is a naphthalenesulfonamide derivative that acts as a potent antagonist of calmodulin (IC50 = 22 μM) and is widely used to investigate Ca2+/calmodulin-regulated enzyme activities.,,CAS:…
Product Name : ONO-8130Description:ONO-8130 is an orally bioavailable and selective antagonist of the prostaglandin E2 (PGE2) receptor EP1 with Ki value of 1.9 nM . Prostaglandins contribute to the sensitization…
Product Name : Phospho-JNK1/JNK2/JNK3 (Thr183, Thr221) Recombinant Rabbit Monoclonal Antibody (ST500)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: ST500Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification :…
Product Name : Phospho-JNK1/JNK2/JNK3 (Thr183) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-JNK1/JNK2/JNK3 (Thr183, Thr221) Recombinant Rabbit Monoclonal Antibody (1A9)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 1A9Conjugate : UnconjugatedForm: LiquidConcentration : 2.11 mg/mLPurification : Protein GStorage…
Product Name : Phospho-JNK1/2/3 (Thr183, Tyr185) Polyclonal AntibodySpecies Reactivity: Bovine, Dog, Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage…
Product Name : Phospho-JMJD2B (Thr305) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-JNK (Tyr185) Recombinant Rabbit Monoclonal Antibody (2G8)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 2G8Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage…
Product Name : Phospho-JMJD2B (Ser566) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.35 mg/mLPurification : Protein A, Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-JIP1 (Thr103) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JIP1 (Thr205) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS with…
Product Name : Phospho-JAM A (Tyr280) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1.02 mg/mLPurification : Affinity chromatographyStorage buffer: 0.02M potassium phosphate,…
Product Name : Phospho-JDP2 (Thr148) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JAK3 (Tyr981) Polyclonal AntibodySpecies Reactivity: Human, Mouse, Non-human primate, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer:…
Product Name : Phospho-JAK3 (Tyr980, Tyr981) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.4 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JAK3 (Tyr785) Polyclonal Antibody, FITCSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : FITCForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary…
Product Name : Phospho-JAK3 (Tyr904) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JAK3 (Tyr785) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-JAK3 (Tyr785) Polyclonal Antibody, BiotinSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary…
Product Name : Phospho-JAK2 (Tyr972) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1.12 mg/mLPurification : Affinity chromatographyStorage buffer: 0.02M potassium phosphate, pH…
Product Name : Phospho-JAK2 (Tyr931) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JAK2 (Tyr372) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: 0.02M potassium phosphate, pH…
Product Name : Phospho-JAK2 (Tyr221) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-JAK2 (Tyr1008, Tyr1009) Polyclonal Antibody, FITCSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : FITCForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : Phospho-JAK2 (Tyr119) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JAK2 (Tyr1008, Tyr1009) Polyclonal Antibody, BiotinSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : Phospho-JAK2 (Tyr1008, Tyr1009) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary…
Product Name : Phospho-JAK2 (Tyr1007, Tyr1008) Recombinant Rabbit Monoclonal Antibody (SY24-03)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: SY24-03Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification :…
Product Name : Phospho-JAK2 (Tyr1008) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS with…
Product Name : Phospho-JAK2 (Tyr1007, Tyr1008) Recombinant Polyclonal Antibody (18HCLC)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant PolyclonalType : AntibodyClone: 18HCLCConjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage buffer:…
Product Name : Phospho-JAK2 (Tyr1007, Tyr1008) Recombinant Rabbit Monoclonal Antibody (1A4)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 1A4Conjugate : UnconjugatedForm: LiquidConcentration : 0.25 mg/mLPurification : Affinity chromatographyStorage…
Product Name : Phospho-JAK2 (Tyr1007, Tyr1008) Recombinant Rabbit Monoclonal Antibody (18H13L8)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 18H13L8Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage…
Product Name : Phospho-JAK2 (Tyr1007, Tyr1008) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's…
Product Name : Phospho-JAK2 (Tyr1007, Tyr1008) Polyclonal Antibody, BiotinSpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.5 mg/mLPurification : Antigen affinity chromatographyStorage buffer:…
Product Name : Phospho-JAK2 (Tyr1007) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-JAK1 (Tyr1125) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JAK2/JAK3 (Tyr966, Tyr939) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-JAK1 (Tyr1034, Tyr1035) Polyclonal Antibody, FITCSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : FITCForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : Phospho-JAK1 (Tyr1034, Tyr1035) Polyclonal Antibody, BiotinSpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : BiotinForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : Phospho-JAK1 (Tyr1034, Tyr1035) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5-1.5 mg/mLPurification : Affinity chromatographyStorage buffer: proprietary…
Product Name : Phospho-JAK1 (Tyr1034) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-JAK1 (Tyr1022) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-JAK1 (Tyr1022, Tyr1023) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS,…
Product Name : Phospho-Integrin -beta3 (Tyr773) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : RabbitClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: Dulbecco's PBS, pH…
Product Name : Phospho-Insulin Receptor (Tyr1361) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: 0.02M potassium phosphate,…
Product Name : Phospho-Integrin beta 1 (Tyr783) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: TBS with…
Product Name : Phospho-Insulin Receptor Beta (Tyr1355) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-Insulin Receptor Beta (Tyr1185) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer:…
Product Name : Phospho-Il13Ra1 (Tyr405) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-IkappaB epsilon (Ser161) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Phospho-IkappaB beta (Ser23) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Phospho-IkappaB beta (Ser19) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Phospho-IkB epsilon (Ser22) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IkB beta (Thr19, Ser23) Polyclonal AntibodySpecies Reactivity: Dog, Human, Non-human primateHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage buffer:…
Product Name : Phospho-IkB beta (Thr19) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer:…
Product Name : Phospho-IkB alpha (Ser36) Recombinant Rabbit Monoclonal Antibody (ARC1543)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: ARC1543Conjugate : UnconjugatedForm: LiquidConcentration : 0.25 mg/mLPurification :…
Product Name : Phospho-IkB alpha (Ser32, Ser36) Monoclonal Antibody (RILYB3R), eFluor™ 660, eBioscience™Species Reactivity: Human, MouseHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: RILYB3RConjugate : eFluor™ 660 View additional formats…
Product Name : Phospho-IkB alpha (Ser32, Ser36) Monoclonal Antibody (RILYB3R), PE, eBioscience™Species Reactivity: Human, MouseHost/Isotype : Mouse / IgG2b, kappaClass:MonoclonalType : AntibodyClone: RILYB3RConjugate : PE View additional formats eFluor 660Form:…
Product Name : Phospho-IkB alpha (Ser32, Ser36) Monoclonal Antibody (H.709.9)Species Reactivity: Human, Mouse, Non-human primate, RatHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: H.709.9Conjugate : UnconjugatedForm: LiquidConcentration : 22 µg/mLPurification :…
Product Name : Phospho-IkB alpha (Ser32, Ser36) Monoclonal Antibody (39A1431)Species Reactivity: HumanHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: 39A1431Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer:…
Product Name : Phospho-IkB alpha (Ser32, Ser36) Monoclonal Antibody (39A1413)Species Reactivity: Bovine, Dog, Human, Mouse, Pig, RatHost/Isotype : Mouse / IgG1, kappaClass:MonoclonalType : AntibodyClone: 39A1413Conjugate : UnconjugatedForm: LiquidConcentration : 1.0…
Product Name : Phospho-IkB alpha (Ser32) Recombinant Rabbit Monoclonal Antibody (ST53-05)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: ST53-05Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein…
Product Name : Phospho-IkB alpha (Ser32) Monoclonal Antibody (B.142.7)Species Reactivity: Human, Mouse, Non-human primate, RatHost/Isotype : Rabbit / IgGClass:MonoclonalType : AntibodyClone: B.142.7Conjugate : UnconjugatedForm: LiquidConcentration : 218.3 µg/mLPurification : Affinity…
Product Name : Phospho-IkB alpha (Ser32) Recombinant Polyclonal AntibodySpecies Reactivity: Human, Non-human primateHost/Isotype : Rabbit / IgGClass:Recombinant PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage…
Product Name : Phospho-IkB alpha (Ser32) Recombinant Rabbit Monoclonal Antibody (2D6)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 2D6Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Affinity chromatographyStorage…
Product Name : Phospho-IkB alpha (Ser32) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.63 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-ITK (Tyr512) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IkB Alpha (Ser32, Ser36) Recombinant Rabbit Monoclonal Antibody (1G21)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 1G21Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Protein AStorage…
Product Name : Phospho-ITGB4 (Tyr1494) Polyclonal AntibodySpecies Reactivity: Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 1%…
Product Name : Phospho-ITGB3 (Tyr773) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-ITGB1 (Tyr795) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-ITGB1 (Thr789) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS…
Product Name : Phospho-ITGB1 (Tyr783) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-ITGB1 (Thr788, Thr789) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS, pH…
Product Name : Phospho-ITGB1 (Thr788) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-ITGB1 (Ser785) Polyclonal AntibodySpecies Reactivity: Chicken, Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS,…
Product Name : Phospho-ITGA4 (Ser1027) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-ITCH (Tyr420) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Phospho-IRS2 (Ser1100) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Phospho-ITCH / AIP4 (Tyr420) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Phospho-IRS1 (Tyr612) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS, pH 7.3,…
Product Name : Phospho-IRS1 (Tyr896) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS, pH 7.3,…
Product Name : Phospho-IRS1 (Tyr1179) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS, pH 7.3,…
Product Name : Phospho-IRS1 (Ser794) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-IRS1 (Ser789) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-IRS1 (Ser639) Polyclonal AntibodySpecies Reactivity: Human, Mouse, Non-human primate, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer:…
Product Name : Phospho-IRS1 (Ser636) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS with…
Product Name : Phospho-IRS1 (Ser636, Ser639) Recombinant Polyclonal Antibody (25HCLC)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant PolyclonalType : AntibodyClone: 25HCLCConjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage buffer:…
Product Name : Phospho-IRS1 (Ser616) Recombinant Polyclonal Antibody (26HCLC)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant PolyclonalType : AntibodyClone: 26HCLCConjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage buffer: PBS,…
Product Name : Phospho-IRS1 (Ser612) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.6 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IRS1 (Ser616) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS,…
Product Name : Phospho-IRS1 (Ser332, Ser336) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : Phospho-IRS1 (Ser323) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IRS1 (Ser312) Recombinant Rabbit Monoclonal Antibody (18H26L6)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 18H26L6Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage buffer:…
Product Name : Phospho-IRS1 (Ser312) Recombinant Polyclonal Antibody (18HCLC)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:Recombinant PolyclonalType : AntibodyClone: 18HCLCConjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage buffer:…
Product Name : Phospho-IRS1 (Ser307) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Affinity chromatographyStorage buffer: Dulbecco's PBS, pH…
Product Name : Phospho-IRS1 (Ser312) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS, pH 7.3,…
Product Name : Phospho-IRS1 (Ser1101) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IRS-1 (Ser307) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-IRS-1 (Ser312) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Antigen affinity chromatographyStorage buffer: 25mM…
Product Name : Phospho-IRF7 (Ser477) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IRF5 (Ser437) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IRF7 (Ser437, Ser438) Polyclonal AntibodySpecies Reactivity: MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS with 50%…
Product Name : Phospho-IRF4 (Tyr122, Tyr125) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Phospho-IRF3 (Ser396) Monoclonal Antibody (E.875.8)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:MonoclonalType : AntibodyClone: E.875.8Conjugate : UnconjugatedForm: LiquidConcentration : 46 µg/mLPurification : Affinity chromatographyStorage buffer: 0.01M HEPES,…
Product Name : Phospho-IRF3 (Ser396) Polyclonal AntibodySpecies Reactivity: Human, PigHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: PBS with 50%…
Product Name : Phospho-IRF3 (Ser386) Recombinant Rabbit Monoclonal Antibody (SU03-28)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: SU03-28Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer:…
Product Name : Phospho-IRF3 (Ser386) Recombinant Rabbit Monoclonal Antibody (4H10)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 4H10Conjugate : UnconjugatedForm: LiquidConcentration : 1.03 mg/mLPurification : Protein GStorage buffer:…
Product Name : Phospho-IRF3 (Ser386) Recombinant Rabbit Monoclonal Antibody (ARC1539)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: ARC1539Conjugate : UnconjugatedForm: LiquidConcentration : 0.86 mg/mLPurification : Affinity ChromatographyStorage buffer:…
Product Name : Phospho-IRF3 (Ser386) Polyclonal AntibodySpecies Reactivity: Human, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Phospho-IRF3 (Ser385) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-IRE1 alpha (Tyr628) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Phospho-IRF3 (Ser14) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IRE1 alpha (Ser724) Recombinant Rabbit Monoclonal Antibody (HL1885)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: HL1885Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage…
Product Name : Phospho-IRE1 alpha (Ser724) Recombinant Rabbit Monoclonal Antibody (ARC1607)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: ARC1607Conjugate : UnconjugatedForm: LiquidConcentration : 0.6 mg/mLPurification : Affinity…
Product Name : Phospho-IRE1 alpha (Ser724) Recombinant Rabbit Monoclonal Antibody (1F12)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 1F12Conjugate : UnconjugatedForm: LiquidConcentration : 0.6 mg/mLPurification : Protein GStorage…
Product Name : chlorodiphenylphosphine, 98%Synonym: IUPAC Name : chlorodiphenylphosphaneCAS NO.:1079-66-9Molecular Weight : Molecular formula: C12H10ClPSmiles: ClP(C1=CC=CC=C1)C1=CC=CC=C1Description: Dispase Ethionamide PMID:23075432
Product Name : 3-Bromophenylacetone, 98+%Synonym: IUPAC Name : 1-(3-bromophenyl)propan-2-oneCAS NO.:21906-32-1Molecular Weight : Molecular formula: C9H9BrOSmiles: CC(=O)CC1=CC=CC(Br)=C1Description: Tropisetron Nilotinib PMID:23812309
Product Name : 3-Methylvaleric acid, 99%Synonym: IUPAC Name : CAS NO.Tuberculosis inhibitor 3 :105-43-1Molecular Weight : Molecular formula: Smiles: Description: Enfortumab vedotin-ejfv (solution) PMID:23522542
Product Name : Dichloro(p-cymene)ruthenium(II) dimer, 98%Synonym: IUPAC Name : CAS NO.:52462-29-0Molecular Weight : Molecular formula: Smiles: Description: Dichloro(p-cymene)ruthenium(II) dimer is used as hydrosilylation catalyst and also used as a pharmaceutical…
Product Name : 2',4',6'-Trihydroxyacetophenone hydrate, 98+%Synonym: IUPAC Name : 1-(2,4,6-trihydroxyphenyl)ethan-1-oneCAS NO.:480-66-0Molecular Weight : Molecular formula: C8H8O4Smiles: CC(=O)C1=C(O)C=C(O)C=C1ODescription: 2',4',6'-Trihydroxyacetophenone hydrate is a compound that enhances bile secretion.Allicin Anti-Mouse IFN gamma Antibody…
Product Name : Phospho-IRE1 alpha (Ser551) Polyclonal AntibodySpecies Reactivity: Human, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.44 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IRE1 alpha (Ser724) Polyclonal AntibodySpecies Reactivity: Fruit fly, Goat, Human, Mammal, Mouse, Non-human primate, Pig, Rabbit, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration…
Product Name : Phospho-IRAK4 (Thr345, Ser346) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Silicon(II) oxide, 99.9% (metals basis)Synonym: IUPAC Name : oxidaniumylidynesilanideCAS NO.Osemitamab :10097-28-6Molecular Weight : Molecular formula: OSiSmiles: #Description: For vacuum depositionIL-4 Protein, Mouse PMID:23613863
Product Name : cis-2-Butene-1,4-diol, 96%, remainder trans-isomerSynonym: IUPAC Name : (2Z)-but-2-ene-1,4-diolCAS NO.:6117-80-2Molecular Weight : Molecular formula: C4H8O2Smiles: OC\C=C/CODescription: cis-2-Butene-1, 4-diol is used as a probe for studying isomerization versus hydrogenation…
Product Name : Strontium titanium oxide, S.A. 12.5-25m2/gSynonym: IUPAC Name : CAS NO.:12060-59-2Molecular Weight : Molecular formula: Smiles: Description: Strontium titaniumoxide is used as paint . It has been used as…
Product Name : L(-)-Camphorsulfonic acid, 98%Synonym: IUPAC Name : heptan-1-yl]methanesulfonic acidCAS NO.:35963-20-3Molecular Weight : Molecular formula: C10H16O4SSmiles: CC1(C)C2CC1(CS(O)(=O)=O)C(=O)C2Description: Lamivudine Chloramphenicol PMID:23557924
Product Name : Chromium powder, -60 mesh, 99.95% (metals basis)Synonym: IUPAC Name : chromiumCAS NO.:7440-47-3Molecular Weight : Molecular formula: CrSmiles: Description: Cyproheptadine Tomivosertib PMID:23829314 MedChemExpress (MCE) offers a wide range…
Product Name : 2-Hydroxy-3-methoxybenzoic acid, 98+%Synonym: IUPAC Name : 2-hydroxy-3-methoxybenzoic acidCAS NO.BPC 157 :877-22-5Molecular Weight : Molecular formula: C8H8O4Smiles: COC1=CC=CC(C(O)=O)=C1ODescription: Clarithromycin PMID:23557924 MedChemExpress (MCE) offers a wide range of high-quality…
Product Name : Phospho-IRAK4 (Thr345) Monoclonal Antibody (A8A8)Species Reactivity: Bovine, Dog, Human, MouseHost/Isotype : Mouse / IgG1Class:MonoclonalType : AntibodyClone: A8A8Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage buffer:…
Product Name : Phospho-IRAK4 (Thr342) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Phospho-IRAK2 (Tyr6) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : AluminonSynonym: IUPAC Name : triammonium 5--2-hydroxybenzoateCAS NO.Imipramine hydrochloride :569-58-4Molecular Weight : Molecular formula: C22H25N3O9Smiles: .Zanidatamab .PMID:23381626 .OC1=CC=C(C=C1C()=O)C(C1C=CC(=O)C(=C1)C()=O)C1=CC=C(O)C(=C1)C()=ODescription:
Product Name : Potassium bromide crystal optic disc, 25mm x 4mm, polished both sidesSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Potassium bromide crystal optic disc…
Product Name : 2,3-Dimethyl-1,3-butadiene, 98%, stab. with 100ppm BHTSynonym: IUPAC Name : CAS NO.:513-81-5Molecular Weight : Molecular formula: Smiles: Description: 2,3-Dimethyl-1,3-butadiene undergoes Diels Alder cycloaddition reaction and it also participates…
Product Name : 3,5-Dimethoxy-4-hydroxybenzaldehyde, 98%Synonym: IUPAC Name : 4-hydroxy-3,5-dimethoxybenzaldehydeCAS NO.Olaratumab :134-96-3Molecular Weight : Molecular formula: C9H10O4Smiles: COC1=CC(C=O)=CC(OC)=C1ODescription: Triheptanoin PMID:23756629 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Product Name : 2-(1-Naphthyl)-5-phenyloxazole, laser grade and suitable for scintillation spectrometry, 99+%Synonym: IUPAC Name : 2-(naphthalen-1-yl)-5-phenyl-1,3-oxazoleCAS NO.Toceranib phosphate :846-63-9Molecular Weight : Molecular formula: C19H13NOSmiles: O1C(=CN=C1C1=C2C=CC=CC2=CC=C1)C1=CC=CC=C1Description: Starting with the organic fluor…
Product Name : Metoclopramide hydrochloride, 98%Synonym: IUPAC Name : 4-amino-5-chloro-N--2-methoxybenzamide hydrochlorideCAS NO.DiI :7232-21-5Molecular Weight : Molecular formula: C14H23Cl2N3O2Smiles: Cl.Medroxyprogesterone acetate CCN(CC)CCNC(=O)C1=CC(Cl)=C(N)C=C1OCDescription: PMID:23613863 MedChemExpress (MCE) offers a wide range of high-quality…
Product Name : Phospho-IRAK1 (Thr387) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IRAK1 (Thr100) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IRAK1 (Thr209) Polyclonal AntibodySpecies Reactivity: Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 1%…
Product Name : 2-Chloronicotinoyl chloride, 97%Synonym: IUPAC Name : CAS NO.Baxdrostat :49609-84-9Molecular Weight : Molecular formula: Smiles: Description: Recombinant Protein Expression Services PMID:23659187
Product Name : Linalool, 97%Synonym: IUPAC Name : 3,7-dimethylocta-1,6-dien-3-olCAS NO.Plasmin :78-70-6Molecular Weight : Molecular formula: C10H18OSmiles: CC(C)=CCCC(C)(O)C=CDescription: Ginkgolic Acid PMID:23891445
Product Name : 2-Bromobenzonitrile, 99%Synonym: IUPAC Name : CAS NO.M871 :2042-37-7Molecular Weight : Molecular formula: Smiles: Description: Camrelizumab PMID:29844565
Product Name : 1,4-Dioxane, HPLC Grade, 99% min, packaged under Argon in resealable ChemSeal™ bottlesSynonym: IUPAC Name : 1,4-dioxaneCAS NO.:123-91-1Molecular Weight : Molecular formula: C4H8O2Smiles: C1COCCO1Description: 1,4-Dioxane HPLC Grade is…
Product Name : Carbohydrazide, 97%Synonym: IUPAC Name : CAS NO.:497-18-7Molecular Weight : Molecular formula: Smiles: Description: Carbohydrazide is widely utilized as a curing agent for epoxide-type resins and as an…
Product Name : Indium foil, 2.0mm (0.08in) thick, Puratronic™, 99.998% (metals basis)Synonym: IUPAC Name : indiumCAS NO.:7440-74-6Molecular Weight : Molecular formula: InSmiles: Description: Toripalimab Sofosbuvir PMID:24318587 MedChemExpress (MCE) offers a…
Product Name : Phospho-IRAK-M (Ser510) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IRAK1 (Ser376) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4, with…
Product Name : Phospho-IR/IGF1R beta (Tyr1135, Tyr1136, Tyr1150, Tyr1151) Recombinant Rabbit Monoclonal Antibody (S.326.5)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: S.326.5Conjugate : UnconjugatedForm: LiquidConcentration :…
Product Name : Tetrahydrofurfuryl alcohol, 98%Synonym: IUPAC Name : (oxolan-2-yl)methanolCAS NO.Neostigmine methyl sulfate :97-99-4Molecular Weight : Molecular formula: C5H10O2Smiles: OCC1CCCO1Description: (-)-Ketoconazole PMID:24257686
Product Name : 2,5-Difluorobenzyl bromide, 98%Synonym: IUPAC Name : 2-(bromomethyl)-1,4-difluorobenzeneCAS NO.Halo tag TMR :85117-99-3Molecular Weight : Molecular formula: C7H5BrF2Smiles: FC1=CC=C(F)C(CBr)=C1Description: Olorofim PMID:29844565
Product Name : Dextran Sulfate Sodium SaltSynonym: IUPAC Name : Dextran sulfate sodium saltCAS NO.Glatiramer acetate :9011-18-1Molecular Weight : Molecular formula: Smiles: Description: Argireline PMID:23357584
Product Name : 5,5-Dimethylhydantoin, 97%Synonym: IUPAC Name : CAS NO.:77-71-4Molecular Weight : Molecular formula: Smiles: Description: Rovalpituzumab Trastuzumab deruxtecan PMID:23847952
Product Name : (±)-Propylene oxide, 99.5%, extra pureSynonym: IUPAC Name : 2-methyloxiraneCAS NO.Olokizumab :75-56-9Molecular Weight : Molecular formula: C3H6OSmiles: CC1CO1Description: Bucillamine PMID:24982871 MedChemExpress (MCE) offers a wide range of high-quality…
Product Name : 4-(Dimethylamino)benzonitrile, 95%Synonym: IUPAC Name : 4-(dimethylamino)benzonitrileCAS NO.PLP (139-151) :1197-19-9Molecular Weight : Molecular formula: C9H10N2Smiles: CN(C)C1=CC=C(C=C1)C#NDescription: Nattokinase PMID:23563799 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : 2-Bromo-5-methylbenzoic acid, 98%Synonym: IUPAC Name : 2-bromo-5-methylbenzoic acidCAS NO.Taurodeoxycholic acid :6967-82-4Molecular Weight : Molecular formula: C8H7BrO2Smiles: CC1=CC=C(Br)C(=C1)C(O)=ODescription: Tralokinumab PMID:24670464 MedChemExpress (MCE) offers a wide range of high-quality…
Product Name : Phospho-IR/IGF1R (Tyr1162, Tyr1163) Recombinant Rabbit Monoclonal Antibody (97H9L7)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant MonoclonalType : AntibodyClone: 97H9L7Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage…
Product Name : Phospho-IR/IGF1R (Tyr1165, Tyr1166, Tyr1189, Tyr1190) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1.42 mg/mLPurification : Affinity ChromatographyStorage…
Product Name : Phospho-IR/IGF1R (Tyr1162, Tyr1163) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS, pH…
Product Name : tert-Butylcyclohexane, 99+%Synonym: IUPAC Name : tert-butylcyclohexaneCAS NO.Tetracycline :3178-22-1Molecular Weight : Molecular formula: C10H20Smiles: CC(C)(C)C1CCCCC1Description: Used as pharmaceutical intermediate.Poziotinib PMID:23935843
Product Name : m-Toluamide, 99%Synonym: IUPAC Name : 3-methylbenzamideCAS NO.:618-47-3Molecular Weight : Molecular formula: C8H9NOSmiles: CC1=CC=CC(=C1)C(N)=ODescription: Glecaprevir Acamprosate calcium PMID:23833812
Product Name : (-)-Diethyl D-tartrate, 99%Synonym: IUPAC Name : 1,4-diethyl (2S,3S)-2,3-dihydroxybutanedioateCAS NO.:13811-71-7Molecular Weight : Molecular formula: C8H14O6Smiles: CCOC(=O)(O)(O)C(=O)OCCDescription: Diethyl D(-)-tartrate is mainly used in chiral pharmaceuticals, chiral intermediates and chiral…
Product Name : Nickel(II) bromide trihydrate, 98%Synonym: IUPAC Name : dibromonickel trihydrateCAS NO.:7789-49-3Molecular Weight : Molecular formula: Br2H6NiO3Smiles: O.O.O.BrBrDescription: It is used in Soporific and sedatives pharmaceutical Industry, Photosensitive industry,…
Product Name : Coenzyme Q10, 98%Synonym: IUPAC Name : 2--5,6-dimethoxy-3-methylcyclohexa-2,5-diene-1,4-dioneCAS NO.:303-98-0Molecular Weight : Molecular formula: C59H90O4Smiles: COC1=C(OC)C(=O)C(C\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CCC=C(C)C)=C(C)C1=ODescription: Concizumab (2-Hydroxypropyl)-β-cyclodextrin PMID:23489613 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : Phospho-IR/IGF1R (Tyr1161) Polyclonal AntibodySpecies Reactivity: Human, Mouse, Pig, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Phospho-IR/IGF1R (Tyr1158, Tyr1162, Tyr1163) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's…
Product Name : Phospho-IR/IGF1R (Tyr1158) Polyclonal Antibody, Alexa Fluor™ 488Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : Alexa Fluor™ 488Form: LiquidConcentration : Purification : Size-exclusion chromatographyStorage buffer:…
Product Name : alpha,alpha'-Dibromo-o-xylene, 96%Synonym: IUPAC Name : 1,2-bis(bromomethyl)benzeneCAS NO.:91-13-4Molecular Weight : Molecular formula: C8H8Br2Smiles: BrCC1=CC=CC=C1CBrDescription: 1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine Ajudecunoid A PMID:23415682
Product Name : 4-Biphenylboronic acid, 97%Synonym: IUPAC Name : {-4-yl}boronic acidCAS NO.:5122-94-1Molecular Weight : Molecular formula: C12H11BO2Smiles: OB(O)C1=CC=C(C=C1)C1=CC=CC=C1Description: Darunavir Enapotamab PMID:23916866
Product Name : Citric Acid, Anhydrous p.a.Synonym: IUPAC Name : 2-hydroxypropane-1,2,3-tricarboxylic acidCAS NO.Osemitamab :77-92-9Molecular Weight : Molecular formula: C6H8O7Smiles: OC(=O)CC(O)(CC(O)=O)C(O)=ODescription: Ulixertinib PMID:27102143
Product Name : (1S,2S)-2,5-Diazabicycloheptane dihydrobromide, 98%Synonym: IUPAC Name : 2,5-diazabicycloheptane dihydrobromideCAS NO.:132747-20-7Molecular Weight : Molecular formula: C5H12Br2N2Smiles: Br.PMID:28038441 Br.C1NC2CNC1C2Description:
Product Name : Sodium selenate, 98%Synonym: IUPAC Name : CAS NO.:13410-01-0Molecular Weight : Molecular formula: Smiles: Description: 24(S)-Hydroxycholesterol Fenbendazole PMID:23710097 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : 3,5-Bis(methoxycarbonyl)benzeneboronic acid pinacol ester, 97%Synonym: IUPAC Name : 1,3-dimethyl 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzene-1,3-dicarboxylateCAS NO.:944392-68-1Molecular Weight : Molecular formula: C16H21BO6Smiles: COC(=O)C1=CC(=CC(=C1)B1OC(C)(C)C(C)(C)O1)C(=O)OCDescription: Ciprofloxacin Nordihydroguaiaretic acid PMID:23439434 MedChemExpress (MCE) offers a wide range…
Product Name : Phospho-IP3 Receptor 1 (Ser1764) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage…
Product Name : Phospho-IP3 Receptor 1 (Tyr353) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer:…
Product Name : Phospho-IR/IGF1R (Tyr1158) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS, pH 7.3,…
Product Name : 4-O-Benzyl-D-glucal, 97%Synonym: IUPAC Name : CAS NO.Alirocumab (anti-PCSK9) :Molecular Weight : Molecular formula: Smiles: Description: Durvalumab PMID:35126464
Product Name : (R)-3-(Boc-amino)-3-phenylpropionic acid, 95%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: IL-13 Protein, Human Rebamipide PMID:23381626
Product Name : Deoxyribonucleic acid, salmon testesSynonym: IUPAC Name : Deoxyribonucleic acidCAS NO.Nivolumab :9007-49-2Molecular Weight : 0.Otilonium bromide 00Molecular formula: Smiles: *Description: PMID:28440459
Product Name : 2-Amino-5-methoxybenzonitrile, 95%Synonym: IUPAC Name : 2-amino-5-methoxybenzonitrileCAS NO.:23842-82-2Molecular Weight : Molecular formula: C8H8N2OSmiles: COC1=CC(C#N)=C(N)C=C1Description: Rofecoxib Adenosylhomocysteinase PMID:24563649 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Product Name : 2-Amino-5-nitrothiazole, 97%Synonym: IUPAC Name : 5-nitro-1,3-thiazol-2-amineCAS NO.Ranolazine :121-66-4Molecular Weight : Molecular formula: C3H3N3O2SSmiles: NC1=NC=C(S1)()=ODescription: Ceftriaxone PMID:24190482 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and…
Product Name : Sodium 1-octanesulfonate monohydrate, 99+%Synonym: IUPAC Name : sodium hydrate octane-1-sulfonateCAS NO.:207596-29-0Molecular Weight : Molecular formula: C8H19NaO4SSmiles: O.Nociceptin .Minocycline hydrochloride CCCCCCCCS()(=O)=ODescription: Sodium 1-octanesulfonate monohydrate is used as an…
Product Name : Phospho-IP3 Receptor 1 (Ser1756) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer:…
Product Name : Phospho-IP3 Receptor 1 (Ser1588, Ser1598) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity…
Product Name : Phospho-INSR (Tyr999) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Chloro(methyl)diphenylsilane, 97%Synonym: IUPAC Name : chloro(methyl)diphenylsilaneCAS NO.:144-79-6Molecular Weight : Molecular formula: C13H13ClSiSmiles: C(Cl)(C1=CC=CC=C1)C1=CC=CC=C1Description: Chloro(methyl)diphenylsilane is used in agrochemical, pharmaceutical and dyestuff field .Pralatrexate Vilobelimab PMID:23800738
Product Name : Terbium(III) nitrate hexahydrate, 99.99+%, (trace metal basis)Synonym: IUPAC Name : terbium(3+) hexahydrate trinitrateCAS NO.Odetiglucan :13451-19-9Molecular Weight : Molecular formula: H12N3O15TbSmiles: O.Purmorphamine O.PMID:23672196 O.O.O.O..()=O.()=O.()=ODescription:
Product Name : Ethanolamine hydrochloride, 98+%Synonym: IUPAC Name : hydrogen 2-aminoethan-1-ol chlorideCAS NO.:2002-24-6Molecular Weight : Molecular formula: C2H8ClNOSmiles: .Rosuvastatin Calcium .Pindolol NCCODescription: PMID:23522542
Product Name : Yttrium Cobalt lump, REacton™, 99.9% (REO)Synonym: IUPAC Name : CAS NO.Acetaminophen :Molecular Weight : Molecular formula: Smiles: Description: Linperlisib PMID:23439434
Product Name : 4-Bromo-2,5-difluorophenol, 99%Synonym: IUPAC Name : 4-bromo-2,5-difluorophenolCAS NO.:486424-36-6Molecular Weight : Molecular formula: C6H3BrF2OSmiles: OC1=CC(F)=C(Br)C=C1FDescription: 4-Bromo-2,5-difluorophenol is used as a raw material in organic synthesis.ME-344 Used in the synthesis…
Product Name : 1,3,5-Tri-tert-butylbenzene, 97+%Synonym: IUPAC Name : 1,3,5-tri-tert-butylbenzeneCAS NO.Ficlatuzumab :1460-02-2Molecular Weight : Molecular formula: C18H30Smiles: CC(C)(C)C1=CC(=CC(=C1)C(C)(C)C)C(C)(C)CDescription: 1,3,5-Tri-tert-butylbenzene is used in the preparation of sandwich complexes of scandium, yttrium and…
Product Name : (R)-1-Boc-3-hydroxypiperidine, 97%Synonym: IUPAC Name : tert-butyl 3-hydroxypiperidine-1-carboxylateCAS NO.:143900-43-0Molecular Weight : Molecular formula: C10H19NO3Smiles: CC(C)(C)OC(=O)N1CCCC(O)C1Description: (R)-1-Boc-3-hydroxypiperidine has been used as a reactant for the synthesis of piperidinyl and…
Product Name : Phospho-INSR (Tyr1361) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-INSR (Tyr972) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS, pH…
Product Name : Phospho-INSR (Tyr1355) Polyclonal AntibodySpecies Reactivity: Human, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : 2-Propene-1-sulfonic acid sodium salt, 95%, pract.Synonym: IUPAC Name : sodium prop-2-ene-1-sulfonateCAS NO.Custom Synthesis of Stable Isotope-Labeled Compounds :2495-39-8Molecular Weight : Molecular formula: C3H5NaO3SSmiles: .Omburtamab S(=O)(=O)CC=CDescription: PMID:24455443
Product Name : 6-Fluoro-2-methylquinoline, 98+%Synonym: IUPAC Name : 6-fluoro-2-methylquinolineCAS NO.:1128-61-6Molecular Weight : Molecular formula: C10H8FNSmiles: CC1=CC=C2C=C(F)C=CC2=N1Description: Metal-free transfer hydrogenation of 6-fluoro-2-methylquinoline by employing several chiral Bronsted acid catalysts was carried…
Product Name : Molybdenum(VI) sulfide, 97%Synonym: IUPAC Name : CAS NO.Olsalazine :Molecular Weight : Molecular formula: Smiles: Description: Mirvetuximab PMID:23819239
Product Name : Strontium, Natural Sr, plasma standard solution, Specpure™, Natural Sr 100μg/mLSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Sarecycline hydrochloride Gadopentetate dimeglumine PMID:24563649
Product Name : Dibenzyl succinate, 98%Synonym: IUPAC Name : CAS NO.:103-43-5Molecular Weight : Molecular formula: Smiles: Description: Dibenzyl succinate is used as an organic chemical synthesis intermediate.N6-Ethyladenosine L67 PMID:32695810 MedChemExpress…
Product Name : 2-Amino-4-(1-naphthyl)thiazole, 97%Synonym: IUPAC Name : CAS NO.Dabrafenib :56503-96-9Molecular Weight : Molecular formula: Smiles: Description: Alirocumab (anti-PCSK9) PMID:25046520 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : Phospho-INSR (Tyr1334) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS,…
Product Name : Phospho-INSR (Tyr1185) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein A, Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : Phospho-INSR (Tyr1328) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS, pH 7.3,…
Product Name : 4-Bromo-2-methoxyphenol, 98%Synonym: IUPAC Name : 4-bromo-2-methoxyphenolCAS NO.Rimonabant :7368-78-7Molecular Weight : Molecular formula: C7H7BrO2Smiles: COC1=CC(Br)=CC=C1ODescription: M871 PMID:26895888
Product Name : 3-(Trifluoromethyl)benzyl alcohol, 97%Synonym: IUPAC Name : methanolCAS NO.Adefovir dipivoxil :349-75-7Molecular Weight : Molecular formula: C8H7F3OSmiles: OCC1=CC=CC(=C1)C(F)(F)FDescription: SPP1 Protein, Human (HEK 293, His) PMID:23891445
Product Name : Bis(cyclopentadienyl)zirconium dihydride, 98%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Bis(cyclopentadienyl)zirconium dihydride, is used as a pharmaceutical intermediate and in chemical industry.Datopotamab (±)-Clopidogrel…
Product Name : Magnesium phthalocyanine, tech. 90%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Magnesium phthalocyanine is used in preparing membrane sensors for cyanide ions.Dispase Also…
Product Name : Copper slug, 3.175mm (0.125 in.) dia. x 6.35mm (0.25 in.) length, Puratronic™, 99.9999% (metals basis)Synonym: IUPAC Name : copperCAS NO.Elacestrant :7440-50-8Molecular Weight : Molecular formula: CuSmiles: Description:…
Product Name : Platinum Combustion Boat, Top length 80mm, width 10mm, Ht 8mm, Base Thickness 0.20mm, Capacity = 6.0mLSynonym: IUPAC Name : CAS NO.Ibezapolstat :Molecular Weight : Molecular formula: Smiles:…
Product Name : 2-Bromo-4'-nitroacetophenone, 95%Synonym: IUPAC Name : 2-bromo-1-(4-nitrophenyl)ethan-1-oneCAS NO.:99-81-0Molecular Weight : Molecular formula: C8H6BrNO3Smiles: (=O)C1=CC=C(C=C1)C(=O)CBrDescription: Apramycin sulfate Cidofovir PMID:23907051 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : Phospho-INSR (Thr1375) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4, with…
Product Name : Phospho-INPPL1 (Tyr986, Tyr987) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : Phospho-INSR (Thr1160) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: liquidConcentration : 0.25 mg/mLPurification : Antigen Affinity ChromatographyStorage buffer: 10mM HEPES, pH…
Product Name : 2-Hydroxybenzyl alcohol, 97%Synonym: IUPAC Name : 2-(hydroxymethyl)phenolCAS NO.:90-01-7Molecular Weight : Molecular formula: C7H8O2Smiles: OCC1=CC=CC=C1ODescription: Bezafibrate ITE PMID:23937941
Product Name : (1,3-Dioxan-2-ylethyl)magnesium bromide, 0.5M solution in THF, AcroSeal™Synonym: IUPAC Name : 2--1,3-dioxaneCAS NO.Baicalein :78078-50-9Molecular Weight : Molecular formula: C6H11BrMgO2Smiles: BrCCC1OCCCO1Description: Reproxalap PMID:24733396
Product Name : tert-Butyl chloroacetate, 97%Synonym: IUPAC Name : tert-butyl 2-chloroacetateCAS NO.:107-59-5Molecular Weight : Molecular formula: C6H11ClO2Smiles: CC(C)(C)OC(=O)CClDescription: Eicosapentaenoic Acid Crenezumab PMID:23671446
Product Name : Sodium perrhenate, 99+% (metals basis), Re 68%Synonym: IUPAC Name : sodium rheniumoylolateCAS NO.:13472-33-8Molecular Weight : Molecular formula: NaO4ReSmiles: .Allopurinol (=O)(=O)=ODescription: Sodium perrhenate is used as a precursor…
Product Name : Manganese(II) carbonate, Mn 44% minSynonym: IUPAC Name : manganese(2+) carbonateCAS NO.:598-62-9Molecular Weight : Molecular formula: CMnO3Smiles: .C()=ODescription: Pigment, varnish drierManganese(II) carbonate is used as an additive to…
Product Name : n-Hexane, for residue and pesticides anal., ca. 95% n-HexaneSynonym: IUPAC Name : hexaneCAS NO.:110-54-3Molecular Weight : Molecular formula: C6H14Smiles: CCCCCCDescription: Flutamide Empagliflozin PMID:26644518 MedChemExpress (MCE) offers a…
Product Name : Phospho-INPPL1 (Tyr1135) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50%…
Product Name : Phospho-INCENP (Thr59) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-ILK (Thr173) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein A, Antigen affinity chromatographyStorage buffer: PBS,…
Product Name : 3-Acetyl-2,5-dimethylthiophene, 99%Synonym: IUPAC Name : 1-(2,5-dimethylthiophen-3-yl)ethan-1-oneCAS NO.:2530-10-1Molecular Weight : Molecular formula: C8H10OSSmiles: CC(=O)C1=C(C)SC(C)=C1Description: It is used in the synthesis of heterocyclic ketimines, 3-acetyl-2,5-dimethylthiophene thiosemicarbazone and 3-acetyl-2,5- dimethylthiophene…
Product Name : 2-Methyl-N-(3-oxetanylidene)propane-2-sulfinamide, 95%Synonym: IUPAC Name : 2-methyl-N-(oxetan-3-ylidene)propane-2-sulfinamideCAS NO.Baricitinib :1158098-73-7Molecular Weight : Molecular formula: C7H13NO2SSmiles: CC(C)(C)S(=O)N=C1COC1Description: It is an important raw material and intermediate used in organic synthesis, pharmaceuticals,…
Product Name : Lactic acid, 1.0N Standardized SolutionSynonym: IUPAC Name : 2-hydroxypropanoic acidCAS NO.:50-21-5Molecular Weight : Molecular formula: C3H6O3Smiles: CC(O)C(O)=ODescription: Cobimetinib AZ304 PMID:36014399
Product Name : 3-Chloro-4-fluorobenzenesulfonyl chloride, 98%Synonym: IUPAC Name : 3-chloro-4-fluorobenzene-1-sulfonyl chlorideCAS NO.Primidone :91170-93-3Molecular Weight : Molecular formula: C6H3Cl2FO2SSmiles: FC1=CC=C(C=C1Cl)S(Cl)(=O)=ODescription: Tepotinib PMID:23664186
Product Name : 4-Fluorobenzylamine, 97%Synonym: IUPAC Name : 1-(4-fluorophenyl)methanamineCAS NO.Vilazodone :140-75-0Molecular Weight : Molecular formula: C7H8FNSmiles: NCC1=CC=C(F)C=C1Description: Propidium Iodide PMID:24487575 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : 1-Bromo-2-butanone, 90%, stabilizedSynonym: IUPAC Name : 1-bromobutan-2-oneCAS NO.Kaempferol :816-40-0Molecular Weight : Molecular formula: C4H7BrOSmiles: CCC(=O)CBrDescription: Tetracycline PMID:24211511 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : 4-Methoxybenzophenone, 98+%Synonym: IUPAC Name : (4-methoxyphenyl)(phenyl)methanoneCAS NO.:611-94-9Molecular Weight : Molecular formula: C14H12O2Smiles: COC1=CC=C(C=C1)C(=O)C1=CC=CC=C1Description: 4-Methoxybenzophenone and its analogues showed diverse plant growth-regulating actions such as inhibition of shoot…
Product Name : Phospho-ILK (Ser343) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-ILK-1 (Thr173) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-ILK (Ser246) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4, with…
Product Name : 2-(Trifluoromethoxy)benzaldehyde, 96%Synonym: IUPAC Name : 2-(trifluoromethoxy)benzaldehydeCAS NO.:94651-33-9Molecular Weight : Molecular formula: C8H5F3O2Smiles: FC(F)(F)OC1=CC=CC=C1C=ODescription: Andrographolide Bevacizumab PMID:31085260
Product Name : Hexaphenylbenzene, 98+%Synonym: IUPAC Name : 2,3,4,5,6-pentaphenyl-1,1'-biphenylCAS NO.:992-04-1Molecular Weight : Molecular formula: C42H30Smiles: C1=CC=C(C=C1)C1=C(C2=CC=CC=C2)C(C2=CC=CC=C2)=C(C2=CC=CC=C2)C(C2=CC=CC=C2)=C1C1=CC=CC=C1Description: Hexaphenylbenzene was used to prepare the fluorescent nanorods used for the detection of trinitrotoulene…
Product Name : 1H-Pyrazole-1-carboxamidine monohydrochloride, 99%Synonym: IUPAC Name : 1H-pyrazole-1-carboximidamideCAS NO.Diroximel fumarate :4023-02-3Molecular Weight : Molecular formula: C4H6N4Smiles: NC(=N)N1C=CC=N1Description: Tafamidis PMID:23724934
Product Name : 3-Chloro-4-fluoro-5-nitrobenzotrifluoride, 98%Synonym: IUPAC Name : CAS NO.Galanthamine :101646-02-0Molecular Weight : Molecular formula: Smiles: Description: Recombinant Protein Expression Services PMID:23795974
Product Name : Silicon lump, 10cm (3.9in) & down, 98.4% (metals basis)Synonym: IUPAC Name : siliconCAS NO.Etoricoxib :7440-21-3Molecular Weight : Molecular formula: SiSmiles: Description: FIPI PMID:23789847 MedChemExpress (MCE) offers a…
Product Name : Phenylacetyl chloride, 98%Synonym: IUPAC Name : 2-phenylacetyl chlorideCAS NO.:103-80-0Molecular Weight : Molecular formula: C8H7ClOSmiles: ClC(=O)CC1=CC=CC=C1Description: Phenylacetyl chloride is used in the preparation of 1,2-diphenyl-ethanone by reaction with…
Product Name : Phospho-ILK-1 (Ser246) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-IL4R (Tyr497) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Antigen affinity chromatographyStorage buffer: Dulbecco's PBS,…
Product Name : Phospho-IL2 Receptor beta (Tyr364) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer:…
Product Name : Triphenylene, 98%Synonym: IUPAC Name : triphenyleneCAS NO.:217-59-4Molecular Weight : Molecular formula: C18H12Smiles: C1=CC=C2C(=C1)C1=CC=CC=C1C1=CC=CC=C21Description: Triphenylene is used in optics and electronics.1,2-Dioleoyl-sn-glycero-3-phosphoethanolamine It is also used as a discotic…
Product Name : 1-Boc-piperazine, 99%Synonym: IUPAC Name : CAS NO.:57260-71-6Molecular Weight : Molecular formula: Smiles: Description: 1-Boc-piperazine is useful for the preparation of (m-phenoxy)phenyl substituted piperazine derivatives.Lamivudine It is also…
Product Name : Barium fluoride, 99%Synonym: IUPAC Name : barium(2+) difluorideCAS NO.:7787-32-8Molecular Weight : Molecular formula: BaF2Smiles: ..Description: It finds applications in ceramic flux, glass manufacturing, metallurgy, electronics and dry-film…
Product Name : 5-Bromo-2-hydroxybenzeneboronic acid, 96%Synonym: IUPAC Name : (5-bromo-2-hydroxyphenyl)boronic acidCAS NO.:89598-97-0Molecular Weight : Molecular formula: C6H6BBrO3Smiles: OB(O)C1=C(O)C=CC(Br)=C1Description: GCN2 modulator-1 Onvansertib PMID:25429455
Product Name : 3-Hydroxyanthranilic acid, 97%Synonym: IUPAC Name : CAS NO.:548-93-6Molecular Weight : Molecular formula: Smiles: Description: Plitidepsin IL-2 Protein, Mouse PMID:23522542 MedChemExpress (MCE) offers a wide range of high-quality…
Product Name : BOC-L-Proline, 99+%Synonym: IUPAC Name : 1-pyrrolidine-2-carboxylic acidCAS NO.Ibuprofen (sodium) :15761-39-4Molecular Weight : Molecular formula: C10H17NO4Smiles: CC(C)(C)OC(=O)N1CCCC1C(O)=ODescription: DTT PMID:25105126 MedChemExpress (MCE) offers a wide range of high-quality research…
Product Name : L-2-Aminoadipic acid, 98%Synonym: IUPAC Name : (2S)-2-aminohexanedioic acidCAS NO.:1118-90-7Molecular Weight : Molecular formula: C6H11NO4Smiles: N(CCCC(O)=O)C(O)=ODescription: L-2-Aminoadipic acid is an important raw material and intermediate used in organic…
Product Name : Phospho-IL10RA (Tyr496) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH 7.4, with…
Product Name : Phospho-IL10RA (Ser319, Ser323) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Phospho-IL-7Ra (Tyr449) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : 4-(Aminomethyl)pyridine, 98%Synonym: IUPAC Name : 1-(pyridin-4-yl)methanamineCAS NO.:3731-53-1Molecular Weight : Molecular formula: C6H8N2Smiles: NCC1=CC=NC=C1Description: Artesunate Saquinavir Mesylate PMID:24957087
Product Name : 2,6-Dichloro-4-nitroaniline, 95%Synonym: IUPAC Name : 2,6-dichloro-4-nitroanilineCAS NO.:99-30-9Molecular Weight : Molecular formula: C6H4Cl2N2O2Smiles: NC1=C(Cl)C=C(C=C1Cl)()=ODescription: It is used as dyestuff, agricultural and pharmaceutical intermediate.Elexacaftor AD4 PMID:23937941
Product Name : 5-Fluoro-2-nitrobenzotrifluoride, 98+%Synonym: IUPAC Name : 4-fluoro-1-nitro-2-(trifluoromethyl)benzeneCAS NO.:393-09-9Molecular Weight : Molecular formula: C7H3F4NO2Smiles: (=O)C1=CC=C(F)C=C1C(F)(F)FDescription: 5-Fluoro-2-nitrobenzotrifluoride may be used as monomer in the synthesis of hyperbranched poly(aryl ether).Tazobactam sodium…
Product Name : Iron sputtering target, 50.8mm (2.0in) dia x 6.35mm (0.250in) thick, 99.95% (metals basis)Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Iron sputtering target…
Product Name : trans-Dichlorobis(diethylsulfide)platinum(II), Pt 43.7%Synonym: IUPAC Name : bis((ethylsulfanyl)ethane); dichloroplatinumbis(ylium)CAS NO.:15337-84-5Molecular Weight : Molecular formula: C8H20Cl2PtS2Smiles: ClCl.Isradipine CCSCC.Tranexamic acid CCSCCDescription: It is used in Hydrosilylation.PMID:24065671 Platinum(II) complexes of diethylsulfide…
Product Name : Tantalum(V) chloride, 99.8% (metals basis)Synonym: IUPAC Name : tantalum(5+) pentachlorideCAS NO.:7721-01-9Molecular Weight : Molecular formula: Cl5TaSmiles: .....Description: In chlorination of organic substances, as an intermediate, and in…
Product Name : Phospho-IL-7 Receptor alpha Chain (Tyr449) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.72 mg/mLPurification : Affinity chromatographyStorage…
Product Name : Phospho-IKK gamma (Ser376) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : Purification : Antigen affinity chromatographyStorage buffer: 0.01M HEPES, pH…
Product Name : Phospho-IKK gamma (Ser85) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : (S)-3-Amino-3-phenylpropanoic acid ethyl ester hydrochloride, 95%, 98% eeSynonym: IUPAC Name : CAS NO.AD 01 :167834-24-4Molecular Weight : Molecular formula: Smiles: Description: Docetaxel PMID:24182988
Product Name : 2'-Deoxyguanosine Monohydrate, Synthetic, >98% (Dry Basis)Synonym: IUPAC Name : 2-amino-9--6,9-dihydro-1H-purin-6-one hydrateCAS NO.Tenofovir Disoproxil fumarate :312693-72-4Molecular Weight : Molecular formula: C10H15N5O5Smiles: O.Hemin NC1=NC2=C(N=CN22C(O)(CO)O2)C(=O)N1Description: PMID:35116795
Product Name : Nefazodone hydrochloride, 98+%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: An antidepressant acts by modifying serotonin transmission.Theaflavin Mixed 5-HT2A serotonin receptor antagonist/serotonin uptake…
Product Name : 1,4-Dioxane, HPLC Grade, 99% minSynonym: IUPAC Name : 1,4-dioxaneCAS NO.Ixazomib citrate :123-91-1Molecular Weight : Molecular formula: C4H8O2Smiles: C1COCCO1Description: 1,4-Dioxane HPLC Grade is used as a mobile phase…
Product Name : Sodium pentacyanonitrosylferrate(III) dihydrate, 98+%Synonym: IUPAC Name : disodium pentacyano(oxidaniumylidyneamino)ironbis(ylium) dihydrateCAS NO.:13755-38-9Molecular Weight : Molecular formula: C5H4FeN6Na2O3Smiles: O.O...N#C(C#N)(C#N)(C#N)(C#N)#Description: Sodium pentacyanonitrosylferrate(III) dihydrate, is used as a vasodilator drug to…
Product Name : Buffer solution pH 4.00 (+/-0.022 @ 25oC) Colored Red Specpure NIST TraceableSynonym: IUPAC Name : CAS NO.:1310-73-2Molecular Weight : Molecular formula: Smiles: Description: Buffer solutions are used…
Product Name : Phospho-IKK epsilon (Ser172) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IKK beta (Tyr199) Polyclonal AntibodySpecies Reactivity: Human, Mouse, Non-human primate, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage…
Product Name : Phospho-IKK beta (Tyr188) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : 4-Bromo-2-methyl-6-nitroaniline, 97%Synonym: IUPAC Name : 4-bromo-2-methyl-6-nitroanilineCAS NO.:77811-44-0Molecular Weight : Molecular formula: C7H7BrN2O2Smiles: CC1=CC(Br)=CC(=C1N)()=ODescription: It is used in the design and synthesis of CK2 inhibitors and in the…
Product Name : (R)-(+)-1,2-Epoxybutane, 98%Synonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Resibufogenin Chlorogenic acid PMID:32926338
Product Name : Potassium sulfate, ACS, 99.0% minSynonym: IUPAC Name : dipotassium sulfateCAS NO.:7778-80-5Molecular Weight : Molecular formula: K2O4SSmiles: ..S()(=O)=ODescription: Potassium sulfate is used in the production of fertilizers (i.NMDA…
Product Name : HEPES, 1M Solution, pH 7.3, Molecular Biology Grade, UltrapureSynonym: IUPAC Name : 2-ethane-1-sulfonic acidCAS NO.:7365-45-9Molecular Weight : Molecular formula: C8H18N2O4SSmiles: OCCN1CCN(CCS(O)(=O)=O)CC1Description: Loxapine succinate Alpha-Estradiol PMID:27217159
Product Name : Titanium wire, 0.81mm (0.032in) dia x 90cm (35in) long, annealed, 99.7% (metals basis)Synonym: IUPAC Name : titaniumCAS NO.Dihydroergotamine mesylate :7440-32-6Molecular Weight : Molecular formula: TiSmiles: Description: ARI-1…
Product Name : Chlorodiphenylphosphine, 97%Synonym: IUPAC Name : chlorodiphenylphosphaneCAS NO.:1079-66-9Molecular Weight : Molecular formula: C12H10ClPSmiles: ClP(C1=CC=CC=C1)C1=CC=CC=C1Description: Chlorodiphenylphosphine is used to introduce the diphenylphosphinyl moiety by aryl ortho-lithiation.Epirubicin hydrochloride It is…
Product Name : 1-Bromo-4-iodonaphthalene, 98%Synonym: IUPAC Name : 1-bromo-4-iodonaphthaleneCAS NO.Chamaejasmenin A :63279-58-3Molecular Weight : Molecular formula: C10H6BrISmiles: BrC1=CC=C(I)C2=CC=CC=C12Description: It is used as an OLED material.Agarose PMID:23546012 MedChemExpress (MCE) offers a…
Product Name : Phospho-IKK beta (Ser740) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : Phospho-IKK beta (Ser474) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 1%…
Product Name : Phospho-IKK beta (Ser476) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50%…
Product Name : 9-Fluorenone-4-carboxylic acid, 98+%Synonym: IUPAC Name : 9-oxo-9H-fluorene-4-carboxylic acidCAS NO.:6223-83-2Molecular Weight : Molecular formula: C14H8O3Smiles: OC(=O)C1=CC=CC2=C1C1=CC=CC=C1C2=ODescription: Dexamethasone K67 PMID:23937941
Product Name : 5-Chloro-4-nitrothiophene-2-sulfonyl chloride, 98%Synonym: IUPAC Name : 5-chloro-4-nitrothiophene-2-sulfonyl chlorideCAS NO.Simtuzumab :58457-24-2Molecular Weight : Molecular formula: C4HCl2NO4S2Smiles: (=O)C1=C(Cl)SC(=C1)S(Cl)(=O)=ODescription: Anti-Mouse IFNAR1 Antibody PMID:23907521
Product Name : Tin(II) iodide, ultra dry, 99.999% (metals basis)Synonym: IUPAC Name : λ²-tin(2+) diiodideCAS NO.Trospium chloride :10294-70-9Molecular Weight : Molecular formula: I2SnSmiles: ..Description: Tin(II) iodide is used to prepare…
Product Name : 1-Butanol, Ultrapure, Spectrophotometric Grade, 99.0+%Synonym: IUPAC Name : butan-1-olCAS NO.:71-36-3Molecular Weight : Molecular formula: C4H10OSmiles: CCCCODescription: 1-Butanol is primarily used as a solvent, as an intermediate in chemical…
Product Name : Bromophenol Blue, pure, 0.1% in waterSynonym: IUPAC Name : CAS NO.D-Galactose :115-39-9Molecular Weight : Molecular formula: Smiles: Description: (-)-Blebbistatin PMID:24377291 MedChemExpress (MCE) offers a wide range of…
Product Name : Trifluoromethanesulfonic acid, 98+%Synonym: IUPAC Name : trifluoromethanesulfonic acidCAS NO.:1493-13-6Molecular Weight : Molecular formula: CHF3O3SSmiles: OS(=O)(=O)C(F)(F)FDescription: Trifluoromethanesulfonic acid acts as a catalyst for esterification reactions and an acidic…
Product Name : Platinum wire, 0.5mm (0.02in) dia, Premion™, 99.997% (metals basis)Synonym: IUPAC Name : platinumCAS NO.Triamcinolone :7440-06-4Molecular Weight : Molecular formula: PtSmiles: Description: Dulaglutide PMID:26760947 MedChemExpress (MCE) offers a…
Product Name : Phospho-IKK beta (Ser471) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : Phospho-IKK beta (Ser466) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : Phospho-IKK-b (Tyr199) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Antigen affinity chromatographyStorage buffer: 25mM…
Product Name : Calcium sulfate, anhydrous, 99%Synonym: IUPAC Name : calcium sulfateCAS NO.:7778-18-9Molecular Weight : Molecular formula: CaO4SSmiles: .S()(=O)=ODescription: Used as Portland-cement retarder; tile and plaster; It is the source…
Product Name : Ethyl phenylcyanoacetate, 97%Synonym: IUPAC Name : ethyl 2-cyano-2-phenylacetateCAS NO.:4553-07-5Molecular Weight : Molecular formula: C11H11NO2Smiles: CCOC(=O)C(C#N)C1=CC=CC=C1Description: Adalimumab (anti-TNF-α) Bucillamine PMID:23460641
Product Name : Glycidyl 2-methylphenyl ether, tech. 85%Synonym: IUPAC Name : 2-oxiraneCAS NO.Epalrestat :2210-79-9Molecular Weight : Molecular formula: C10H12O2Smiles: CC1=CC=CC=C1OCC1CO1Description: Tropisetron PMID:27217159
Product Name : 3,5-Difluoro-4-hydroxybenzaldehyde, 97%Synonym: IUPAC Name : 3,5-difluoro-4-hydroxybenzaldehydeCAS NO.:118276-06-5Molecular Weight : Molecular formula: C7H4F2O2Smiles: OC1=C(F)C=C(C=O)C=C1FDescription: 3,5-Difluoro-4-hydroxybenzaldehyde is used in the preparation of (Z)-2,6- difluoro-((2-methyl-5-oxooxazol-4(5H)-ylidene)methyl)phenylacetate.Chlorogenic acid Carboplatin PMID:24078122
Product Name : 2-Chloro-4-fluorobenzyl bromide, 97%Synonym: IUPAC Name : 1-(bromomethyl)-2-chloro-4-fluorobenzeneCAS NO.:45767-66-6Molecular Weight : Molecular formula: C7H5BrClFSmiles: FC1=CC=C(CBr)C(Cl)=C1Description: Pacritinib Isorhamnetin PMID:24179643 MedChemExpress (MCE) offers a wide range of high-quality research chemicals…
Product Name : 3-Amino-5-bromobenzotrifluoride, 97%Synonym: IUPAC Name : 3-bromo-5-(trifluoromethyl)anilineCAS NO.Octreotide acetate :54962-75-3Molecular Weight : Molecular formula: C7H5BrF3NSmiles: NC1=CC(Br)=CC(=C1)C(F)(F)FDescription: IL-4 Protein, Human PMID:23865629 MedChemExpress (MCE) offers a wide range of high-quality…
Product Name : 2-Chloro-3-nitro-5-(trifluoromethyl)pyridine, 95%Synonym: IUPAC Name : 2-chloro-3-nitro-5-(trifluoromethyl)pyridineCAS NO.:72587-15-6Molecular Weight : Molecular formula: C6H2ClF3N2O2Smiles: (=O)C1=C(Cl)N=CC(=C1)C(F)(F)FDescription: Anti-Mouse IL-1a Antibody Neratinib PMID:23537004
Product Name : Phospho-IKK alpha/beta (Ser180, Ser181) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer:…
Product Name : Phospho-IKK alpha/beta (Ser176, Ser180) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer:…
Product Name : Phospho-IKK alpha/beta (Ser176, Ser180) Recombinant Polyclonal Antibody (7HCLC)Species Reactivity: HumanHost/Isotype : Rabbit / IgGClass:Recombinant PolyclonalType : AntibodyClone: 7HCLCConjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Protein AStorage…
Product Name : 4-Chlorophenol, 99%Synonym: IUPAC Name : 4-chlorophenolCAS NO.:106-48-9Molecular Weight : Molecular formula: C6H5ClOSmiles: OC1=CC=C(Cl)C=C1Description: It is used as main raw material of compounding for medicine, dye, plastic and…
Product Name : Phenylpropiolic acid, 98+%Synonym: IUPAC Name : 3-phenylprop-2-ynoic acidCAS NO.Bapineuzumab :637-44-5Molecular Weight : Molecular formula: C9H6O2Smiles: OC(=O)C#CC1=CC=CC=C1Description: Phenylpropiolic acid is used as a Pharmaceutical Intermediates, laboratory chemicals.PP1 PMID:26895888
Product Name : Precious Metals, plasma standard solution, Specpure™, Au, Ir, Os, Pd, Pt, Re, Rh, Ru @ 100μg/mLSynonym: IUPAC Name : CAS NO.Niraparib :Molecular Weight : Molecular formula: Smiles:…
Product Name : 4-Iodopyrazole, 98%Synonym: IUPAC Name : 4-iodo-1H-pyrazoleCAS NO.Naproxen :3469-69-0Molecular Weight : Molecular formula: C3H3IN2Smiles: IC1=CNN=C1Description: Aspirin PMID:23310954
Product Name : 1-Adamantanemethanol, 99%Synonym: IUPAC Name : (adamantan-1-yl)methanolCAS NO.Efalizumab :770-71-8Molecular Weight : Molecular formula: C11H18OSmiles: OCC12CC3CC(CC(C3)C1)C2Description: Eliglustat PMID:24761411
Product Name : tert-Butyldimethylchlorosilane, 97%Synonym: IUPAC Name : tert-butyl(chloro)dimethylsilaneCAS NO.:18162-48-6Molecular Weight : Molecular formula: C6H15ClSiSmiles: CC(C)(C)(C)(C)ClDescription: tert-Butyldimethylchlorosilane is used to protect hydroxyl group in organic synthesis.Trofinetide It finds application in…
Product Name : Pentafluoropropionic anhydride, 98%Synonym: IUPAC Name : 2,2,3,3,3-pentafluoropropanoyl 2,2,3,3,3-pentafluoropropanoateCAS NO.:356-42-3Molecular Weight : Molecular formula: C6F10O3Smiles: FC(F)(F)C(F)(F)C(=O)OC(=O)C(F)(F)C(F)(F)FDescription: SARS-CoV-2 S2 Protein (HEK293, His) Fruquintinib PMID:24202965
Product Name : 2,4-Difluorobenzenesulfonamide, 96%Synonym: IUPAC Name : 2,4-difluorobenzene-1-sulfonamideCAS NO.Oxaliplatin :13656-60-5Molecular Weight : Molecular formula: C6H5F2NO2SSmiles: NS(=O)(=O)C1=CC=C(F)C=C1FDescription: Netarsudil (dimesylate) PMID:23399686
Product Name : Phospho-IKK alpha/beta (Ser176, Ser177) Monoclonal Antibody (J.10.3)Species Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:MonoclonalType : AntibodyClone: J.10.3Conjugate : UnconjugatedForm: LiquidConcentration : 88 µg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : Phospho-IKK alpha/beta (Ser176, Ser177) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer:…
Product Name : Phospho-IKK alpha (Tyr463) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : 4-Bromoaniline, 98+%Synonym: IUPAC Name : 4-bromoanilineCAS NO.:106-40-1Molecular Weight : Molecular formula: C6H6BrNSmiles: NC1=CC=C(Br)C=C1Description: 4-Bromoaniline is used as a precursor in the production of azo dyes and dihydroquinazolines.Saxagliptin…
Product Name : Platinum 75% - iridium(IV) oxide 25%Synonym: IUPAC Name : CAS NO.RITA :Molecular Weight : Molecular formula: Smiles: Description: Velagliflozin PMID:23795974
Product Name : Triphenylphosphine resin, 1% crosslinked with DVB, 1.0-1.5mmol/g, 100-200 meshSynonym: IUPAC Name : triphenylphosphaneCAS NO.:39319-11-4Molecular Weight : Molecular formula: C18H15PSmiles: C1=CC=C(C=C1)P(C1=CC=CC=C1)C1=CC=CC=C1Description: Amlitelimab Marimastat PMID:24318587
Product Name : Calcium stearateSynonym: IUPAC Name : calcium dioctadecanoateCAS NO.:1592-23-0Molecular Weight : Molecular formula: C36H70CaO4Smiles: .TMRE CCCCCCCCCCCCCCCCCC()=O.CCCCCCCCCCCCCCCCCC()=ODescription: Used as a stabilizer and a lubricant in rigid PVC processing, PVC…
Product Name : Ethyl glutaryl chloride, 97%Synonym: IUPAC Name : ethyl 5-chloro-5-oxopentanoateCAS NO.:5205-39-0Molecular Weight : Molecular formula: C7H11ClO3Smiles: CCOC(=O)CCCC(Cl)=ODescription: Ethyl glutaryl chloride is a main cationic monomer, it can bring…
Product Name : 3-Bromo-1H-indazole, 97%Synonym: IUPAC Name : 3-bromo-2H-indazoleCAS NO.Isocarboxazid :40598-94-5Molecular Weight : Molecular formula: C7H5BrN2Smiles: BrC1=C2C=CC=CC2=NN1Description: 1-Oleoyl lysophosphatidic acid (sodium) PMID:23415682
Product Name : 2,5-Bis(4-biphenylyl)-1,3,4-oxadiazole, 99%Synonym: IUPAC Name : bis({-4-yl})-1,3,4-oxadiazoleCAS NO.:2043-06-3Molecular Weight : Molecular formula: C26H18N2OSmiles: O1C(=NN=C1C1=CC=C(C=C1)C1=CC=CC=C1)C1=CC=C(C=C1)C1=CC=CC=C1Description: Lenvatinib GM-CSF Protein, Mouse PMID:32180353
Product Name : 5-Chloro-2-methylaminobenzophenone, 99%Synonym: IUPAC Name : CAS NO.:1022-13-5Molecular Weight : Molecular formula: Smiles: Description: Adalimumab (anti-TNF-α) Glofitamab PMID:24238415
Product Name : Phospho-IKK alpha (Thr23) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Phospho-IKK alpha (Ser176) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.7 mg/mLPurification : Affinity ChromatographyStorage buffer: PBS,…
Product Name : Phospho-IKK alpha/IKKB (Thr23) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : Phenol Red sodium saltSynonym: IUPAC Name : sodium 4-benzen-1-olateCAS NO.:34487-61-1Molecular Weight : Molecular formula: C19H13NaO5SSmiles: .OC1=CC=C(C=C1)C1(OS(=O)(=O)C2=CC=CC=C12)C1=CC=C()C=C1Description: Phenol Red sodium salt commonly employed in cell biology laboratories as…
Product Name : 4-Hydroxyquinoline, 98%Synonym: IUPAC Name : CAS NO.:611-36-9Molecular Weight : Molecular formula: Smiles: Description: 4-Hydroxyquinoline is a medical raw material.Amivantamab Sunitinib Malate PMID:24458656
Product Name : 5-Bromo-4-chloro-3-indolyl-beta-D-galactopyranoside, 98+%Synonym: IUPAC Name : X-galCAS NO.:7240-90-6Molecular Weight : Molecular formula: C23H41Cu2N5O5Smiles: ..CC(O)O.CC(O)O.CN1CCN(CC2=CC(=CC(CN3CCN(C)CC3)=C2O)C#N)CC1Description: It is a substrate for beta-galactosidase, which cleaves the glycosidic bond to give 5-bromo-4-chloro-3-hydroxy-1H-indole,…
Product Name : 4-Amino-6-methoxypyrimidine, 97%Synonym: IUPAC Name : 6-methoxypyrimidin-4-amineCAS NO.Voriconazole :696-45-7Molecular Weight : Molecular formula: C5H7N3OSmiles: COC1=CC(N)=NC=N1Description: Lurbinectedin PMID:24275718
Product Name : Lithium, plasma standard solution, Specpure™ Li 1000μg/mLSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: Danicopan Kanamycins (sulfate) PMID:32926338
Product Name : α,α,α-Trifluoroacetophenone, 99%Synonym: IUPAC Name : 2,2,2-trifluoro-1-phenylethan-1-oneCAS NO.:434-45-7Molecular Weight : Molecular formula: C8H5F3OSmiles: FC(F)(F)C(=O)C1=CC=CC=C1Description: AR7 Sertraline hydrochloride PMID:22664133
Product Name : Silicon granular, virgin poly fines, 99.999% (metals basis)Synonym: IUPAC Name : siliconCAS NO.NAD+ :7440-21-3Molecular Weight : Molecular formula: SiSmiles: Description: Biotin-d2-1 PMID:23819239
Product Name : Iridium wire, 1.0mm (0.04in) dia, 99.8% (metals basis)Synonym: IUPAC Name : iridiumCAS NO.Fluconazole :7439-88-5Molecular Weight : Molecular formula: IrSmiles: Description: Sotigalimab PMID:27108903
Product Name : Phospho-IKK-a (Ser176, Ser180) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Antigen affinity chromatographyStorage buffer:…
Product Name : Phospho-IKK E (Thr501) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: 0.02M potassium phosphate,…
Product Name : Phospho-IKB epsilon (Ser157) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with 50%…
Product Name : 3-(2-Furyl)acrylic acid, 99%Synonym: IUPAC Name : (2E)-3-(furan-2-yl)prop-2-enoic acidCAS NO.TGF beta 1 Protein, Human :539-47-9Molecular Weight : Molecular formula: C7H6O3Smiles: OC(=O)C=CC1=CC=CO1Description: 3-(2-Furyl)acrylic acid is a reactant used in…
Product Name : Calcium sulfate dihydrate, ACS, 98.0-102.0%Synonym: IUPAC Name : calcium dihydrate sulfateCAS NO.:10101-41-4Molecular Weight : Molecular formula: CaH4O6SSmiles: O.Olverembatinib O.Ranolazine .PMID:25046520 S()(=O)=ODescription: Used as portland-cement retarder, tile and…
Product Name : Diethoxydiphenylsilane, 98%Synonym: IUPAC Name : diethoxydiphenylsilaneCAS NO.Panitumumab (anti-EGFR) :2553-19-7Molecular Weight : Molecular formula: C16H20O2SiSmiles: CCO(OCC)(C1=CC=CC=C1)C1=CC=CC=C1Description: Reagent for preparation of diphenylsilylene derivatives of diols by exchange.Monomethyl fumarate PMID:23880095
Product Name : 4-Bromobenzophenone, 97%Synonym: IUPAC Name : (4-bromophenyl)(phenyl)methanoneCAS NO.:90-90-4Molecular Weight : Molecular formula: C13H9BrOSmiles: BrC1=CC=C(C=C1)C(=O)C1=CC=CC=C1Description: Ivermectin Ivosidenib PMID:23695992
Product Name : N-Bromosuccinimide, 99%Synonym: IUPAC Name : 1-bromopyrrolidine-2,5-dioneCAS NO.:128-08-5Molecular Weight : Molecular formula: C4H4BrNO2Smiles: BrN1C(=O)CCC1=ODescription: N-Bromosuccinimide is a chemical reagent used in electrophilic additions and radical substitution reactions in…
Product Name : Copper, plasma standard solution, Specpure™ Cu 10,000μg/mLSynonym: IUPAC Name : CAS NO.MB-07811 :Molecular Weight : Molecular formula: Smiles: Description: Trastuzumab emtansine (solution) PMID:24624203
Product Name : Aluminum, AAS standard solution, Specpure™ Al 1000μg/mLSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: L-Glutamine Ginkgolide B PMID:25269910
Product Name : 4-(Methylsulfinyl)benzeneboronic acid, 98%Synonym: IUPAC Name : CAS NO.:166386-48-7Molecular Weight : Molecular formula: Smiles: Description: Lonidamine Eicosapentaenoic Acid PMID:23805407
Product Name : Phospho-IKB alpha (Tyr42) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Phospho-IKB beta (Ser23) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS…
Product Name : Phospho-IKB alpha (Tyr305) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Tetrahydrofuran, Spectrophotometric grade, 99.7+%, unstab., packaged under Argon in resealable ChemSeal™ bottlesSynonym: IUPAC Name : oxolaneCAS NO.:109-99-9Molecular Weight : Molecular formula: C4H8OSmiles: C1CCOC1Description: Fostamatinib Disodium Cynarin PMID:23329650
Product Name : Thiazole-4-carboxaldehyde, 95%Synonym: IUPAC Name : 1,3-thiazole-4-carbaldehydeCAS NO.:3364-80-5Molecular Weight : Molecular formula: C4H3NOSSmiles: O=CC1=CSC=N1Description: Thiazole-4-carboxaldehyde is used as a intermediate for pharmaceutical.Sotorasib SDMA PMID:25804060
Product Name : Tetramethylcyclopentadiene, mixed isomers, tech. 85%Synonym: IUPAC Name : 1,2,3,4-tetramethylcyclopenta-1,3-dieneCAS NO.:4249-10-9Molecular Weight : Molecular formula: C9H14Smiles: CC1=C(C)C(C)=C(C)C1Description: Tetramethylcyclopentadiene is used in pharmaceutical intermediates.SC66 Phosphatidylethano lamine PMID:28739548
Product Name : Tungsten(V) ethoxideSynonym: IUPAC Name : pentaethoxytungstenCAS NO.:26143-11-3Molecular Weight : Molecular formula: C10H25O5WSmiles: CCO(OCC)(OCC)(OCC)OCCDescription: Tungsten(V) ethoxide is used as an intermediate for sol-gel coatings.Pivekimab Phenylbutazone PMID:23075432
Product Name : 4-Chlorophenoxyacetonitrile, 98%Synonym: IUPAC Name : CAS NO.:3598-13-8Molecular Weight : Molecular formula: Smiles: Description: Varenicline Naproxen PMID:23773119
Product Name : N-Fmoc-L-homoleucine, 95%Synonym: IUPAC Name : (2S)-2-({carbonyl}amino)-5-methylhexanoic acidCAS NO.:180414-94-2Molecular Weight : Molecular formula: C22H25NO4Smiles: CC(C)CC(NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C12)C(O)=ODescription: Streptavidin Sennoside A PMID:23907521
Product Name : Ethyl cis-2-amino-1-cyclohexanecarboxylate hydrochloride, 95%Synonym: IUPAC Name : hydrogen ethyl (1R,2S)-2-aminocyclohexane-1-carboxylate chlorideCAS NO.Hydrocortisone :1127-99-7Molecular Weight : Molecular formula: C9H18ClNO2Smiles: .U0126 .PMID:23927631 CCOC(=O)1CCCC1NDescription:
Product Name : L-Selenocystine, 98%Synonym: IUPAC Name : CAS NO.SCF Protein, Mouse :29621-88-3Molecular Weight : Molecular formula: Smiles: Description: AZD4635 PMID:24065671
Product Name : Phospho-IKB alpha (Ser36) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: TBS…
Product Name : Phospho-IGF2R (Ser2484) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IGFBP3 (Ser183) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Iodomethane, 99%, stab. with copperSynonym: IUPAC Name : iodomethaneCAS NO.Gefitinib :74-88-4Molecular Weight : Molecular formula: CH3ISmiles: CIDescription: Iodomethane is a methylating agent used for alkylating carbon, oxygen,…
Product Name : (S)-(+)-1-Methyl-3-pyrrolidinol, 98%, ee 99%Synonym: IUPAC Name : 1-methylpyrrolidin-3-olCAS NO.Anti-Mouse CTLA-4 Antibody :104641-59-0Molecular Weight : Molecular formula: C5H11NOSmiles: CN1CCC(O)C1Description: Lornoxicam PMID:24635174
Product Name : Copper(II) pyrophosphate hydrate, P{2}O{7} 43.5-48.5%Synonym: IUPAC Name : dicopper(2+) (phosphonatooxy)phosphonateCAS NO.:16570-28-8Molecular Weight : Molecular formula: Cu2O7P2Smiles: .Podofilox .Fmoc-Cys(Trt)-OH P()(=O)OP()()=ODescription: Copper(II) pyrophosphate hydrate is used in printed circuit…
Product Name : Isonicotinamide, 99%Synonym: IUPAC Name : pyridine-4-carboxamideCAS NO.:1453-82-3Molecular Weight : Molecular formula: C6H6N2OSmiles: NC(=O)C1=CC=NC=C1Description: p-Coumaric acid Tedizolid PMID:24025603
Product Name : 4-Methoxybenzoyl chloride, 97%Synonym: IUPAC Name : 4-methoxybenzoyl chlorideCAS NO.:100-07-2Molecular Weight : Molecular formula: C8H7ClO2Smiles: COC1=CC=C(C=C1)C(Cl)=ODescription: 4-Methoxybenzoyl chloride is used in the synthesis of stilbene and dihydrostilbene derivatives…
Product Name : Undecanoic acid, 99%Synonym: IUPAC Name : undecanoic acidCAS NO.:112-37-8Molecular Weight : Molecular formula: C11H22O2Smiles: CCCCCCCCCCC(O)=ODescription: Ligelizumab EIPA PMID:23543429
Product Name : Niobium foil, 0.25mm (0.01in) thick, 99.97% (metals basis excluding Ta), Ta |
Product Name : (S)-3-Amino-3-phenylpropan-1-ol, 95%, 98% eeSynonym: IUPAC Name : 3-amino-3-phenylpropan-1-olCAS NO.Betamethasone valerate :82769-76-4Molecular Weight : Molecular formula: C9H13NOSmiles: NC(CCO)C1=CC=CC=C1Description: Coelenterazine PMID:24406011
Product Name : Phospho-IGF2R (Ser2409) Polyclonal AntibodySpecies Reactivity: Human, MouseHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Phospho-IGF1R beta (Tyr980) Monoclonal Antibody (T.968.0)Species Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:MonoclonalType : AntibodyClone: T.968.0Conjugate : UnconjugatedForm: LiquidConcentration : 31.5 µg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : Phospho-IGF1R beta (Tyr980) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS,…
Product Name : Aminodiphenylmethane, 97%Synonym: IUPAC Name : 1,1-diphenylmethanamineCAS NO.:91-00-9Molecular Weight : Molecular formula: C13H13NSmiles: NC(C1=CC=CC=C1)C1=CC=CC=C1Description: Abacavir sulfate Osimertinib mesylate PMID:24458656
Product Name : Methanol-d4, for NMR, packaged in 0.75 ml ampoules, 99.8 atom % DSynonym: IUPAC Name : (²H₃)methan(²H)olCAS NO.Loxapine succinate :811-98-3Molecular Weight : Molecular formula: CH4OSmiles: OC()()Description: Dihydromyricetin PMID:23075432
Product Name : (1-Hexyl)triphenylphosphonium bromide, 98%Synonym: IUPAC Name : hexyltriphenylphosphanium bromideCAS NO.Gabapentin :4762-26-9Molecular Weight : Molecular formula: C24H28BrPSmiles: .Faricimab CCCCCC(C1=CC=CC=C1)(C1=CC=CC=C1)C1=CC=CC=C1Description: (1-Hexyl)triphenylphosphonium bromide can be used as catalyst in pharmaceutical research.PMID:24883330…
Product Name : Palladium wire, 0.25mm (0.01in) dia, 99.9% (metals basis)Synonym: IUPAC Name : palladiumCAS NO.Seribantumab :7440-05-3Molecular Weight : Molecular formula: PdSmiles: Description: Quinupristin PMID:23991096
Product Name : Tri-(2-furyl)phosphine, 98%Synonym: IUPAC Name : tris(furan-2-yl)phosphaneCAS NO.:5518-52-5Molecular Weight : Molecular formula: C12H9O3PSmiles: O1C=CC=C1P(C1=CC=CO1)C1=CC=CO1Description: Quizartinib Ripretinib PMID:36628218
Product Name : Phthalhydrazide, 99%Synonym: IUPAC Name : 1,4,4a,8a-tetrahydrophthalazine-1,4-dioneCAS NO.:1445-69-8Molecular Weight : Molecular formula: C8H6N2O2Smiles: O=C1N=NC(=O)C2C=CC=CC12Description: Ligelizumab Rofecoxib PMID:24563649
Product Name : Bis(2-benzamidophenyl) disulfide, 97%Synonym: IUPAC Name : N-{2-phenyl}benzamideCAS NO.:135-57-9Molecular Weight : Molecular formula: C26H20N2O2S2Smiles: O=C(NC1=CC=CC=C1SSC1=CC=CC=C1NC(=O)C1=CC=CC=C1)C1=CC=CC=C1Description: Sertindole Abiraterone acetate PMID:23695992
Product Name : Phospho-IGF1R beta (Tyr1316) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1.83 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IGF1R beta (Tyr1346) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : Phospho-IGF1R beta (Tyr1280) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS, pH 7.4,…
Product Name : 4-Aminophthalhydrazide, 98%Synonym: IUPAC Name : CAS NO.:3682-14-2Molecular Weight : Molecular formula: Smiles: Description: A chemiluminescent moleculeLuvixasertib hydrochloride NMDA PMID:23664186
Product Name : 3-Chloro-2-hydroxypyridine, 97%Synonym: IUPAC Name : 3-chloro-1,2-dihydropyridin-2-oneCAS NO.Congo Red :13466-35-8Molecular Weight : Molecular formula: C5H4ClNOSmiles: ClC1=CC=CNC1=ODescription: 3-Chloro-2-hydroxypyridine is used as an organic intermediate.Docetaxel PMID:24275718
Product Name : Cyclohexyl methyl sulfide, 97%Synonym: IUPAC Name : (methylsulfanyl)cyclohexaneCAS NO.Anti-Mouse IFN gamma Antibody :7133-37-1Molecular Weight : Molecular formula: C7H14SSmiles: CSC1CCCCC1Description: Cyclohexyl methyl sulfide is used as a pharmaceutical…
Product Name : Bathocuproin sulfonate disodium salt hydrate, 97%Synonym: IUPAC Name : disodium 2,9-dimethyl-4,7-diphenyl-1,10-phenanthroline-3,8-disulfonateCAS NO.Scopoletin :52698-84-7Molecular Weight : Molecular formula: C26H18N2Na2O6S2Smiles: .Phosphorylase kinase .PMID:24834360 CC1=NC2=C(C=CC3=C2N=C(C)C(=C3C2=CC=CC=C2)S()(=O)=O)C(C2=CC=CC=C2)=C1S()(=O)=ODescription: Used as a stain for…
Product Name : 1-Naphthaleneboronic acid, 97%Synonym: IUPAC Name : (naphthalen-1-yl)boronic acidCAS NO.:13922-41-3Molecular Weight : Molecular formula: C10H9BO2Smiles: OB(O)C1=CC=CC2=CC=CC=C12Description: Praziquantel Nefazodone hydrochloride PMID:24458656
Product Name : Platinum, 1% on gamma alumina powder, reducedSynonym: IUPAC Name : CAS NO.:Molecular Weight : Molecular formula: Smiles: Description: 7-Amino-4-methylcoumarin Oteseconazole PMID:24278086
Product Name : Phospho-IGF1R beta (Tyr1165, Tyr1166) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer:…
Product Name : Phospho-IGF1R beta (Tyr1131) Polyclonal AntibodySpecies Reactivity: HumanHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 0.5 mg/mLPurification : Antigen affinity chromatographyStorage buffer: PBS, pH…
Product Name : Phospho-IGF1R beta (Tyr1161) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Affinity chromatographyStorage buffer: PBS,…
Product Name : n-Hexane, 99+%, for analysisSynonym: IUPAC Name : hexaneCAS NO.Isoliquiritigenin :110-54-3Molecular Weight : Molecular formula: C6H14Smiles: CCCCCCDescription: Spermine PMID:23710097
Product Name : Salicylic acid, 99%Synonym: IUPAC Name : 2-hydroxybenzoic acidCAS NO.:69-72-7Molecular Weight : Molecular formula: C7H6O3Smiles: OC(=O)C1=CC=CC=C1ODescription: Salicylic acid is used as a food preservative as well as in…
Product Name : Hydrogen tetrachloroaurate(III) hydrate, 99.9% (metals basis), Au 49% minSynonym: IUPAC Name : hydrogen tetrachlorogoldtris(ylium)CAS NO.:27988-77-8Molecular Weight : Molecular formula: AuCl4HSmiles: .Cl(Cl)(Cl)ClDescription: Hydrogen tetrachloroaurate(III) hydrate is used for…
Product Name : Tin(II) chloride, anhydrous, 99% minSynonym: IUPAC Name : λ²-tin(2+) dichlorideCAS NO.:7772-99-8Molecular Weight : Molecular formula: Cl2SnSmiles: ..Description: Tin(II) chloride is widely used as a reducing agent in…
Product Name : 4-(4,6-Dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium chloride hydrate, 97+%Synonym: IUPAC Name : 4-(4,6-dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholin-4-ium chlorideCAS NO.Scutellarin :3945-69-5Molecular Weight : Molecular formula: C10H17ClN4O3Smiles: .COC1=NC(=NC(OC)=N1)1(C)CCOCC1Description: 4-(4,6-Dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium chloride hydrate is used as a pharmaceutical intermediate.Cholera toxin…
Product Name : Calcium carbonate, 99+%, ACS reagentSynonym: IUPAC Name : calcium carbonateCAS NO.:471-34-1Molecular Weight : Molecular formula: CCaO3Smiles: .Etrolizumab C()=ODescription: Propylthiouracil PMID:24282960
Product Name : Platinum wire, 0.127mm (0.005in) dia, hard, 99.9% (metals basis)Synonym: IUPAC Name : platinumCAS NO.:7440-06-4Molecular Weight : Molecular formula: PtSmiles: Description: MB-07811 Aficamten PMID:25818744
Product Name : cis,cis-1,3,5-Cyclohexanetriol dihydrate, 98%Synonym: IUPAC Name : CAS NO.:60662-54-6Molecular Weight : Molecular formula: Smiles: Description: Telisotuzumab Girentuximab PMID:28739548
Product Name : Phospho-IGF1R alpha (Thr1163) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS,…
Product Name : Phospho-IGF1R (Tyr980) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : Protein AStorage buffer: PBS with…
Product Name : Phospho-IGF1R (Tyr1346) Polyclonal AntibodySpecies Reactivity: Human, Mouse, RatHost/Isotype : Rabbit / IgGClass:PolyclonalType : AntibodyClone: Conjugate : UnconjugatedForm: LiquidConcentration : 1 mg/mLPurification : sequential chromatographyStorage buffer: PBS, pH…
Product Name : Dextran, MW ca 75,000Synonym: IUPAC Name : DextranCAS NO.:9004-54-0Molecular Weight : Molecular formula: (C6H9O5)n(C6H10O5)mSmiles: O1(O)(-*)O(CO2O(CO-*)(O)(O-*)2O)1ODescription: Dextran, MW ca 75,000 is used as a processing aid, stabilizer, thickener,…
Product Name : 4-Methyl-2-thiazolecarboxaldehyde, 97%Synonym: IUPAC Name : 4-methyl-1,3-thiazole-2-carbaldehydeCAS NO.Irinotecan :13750-68-0Molecular Weight : Molecular formula: C5H5NOSSmiles: CC1=CSC(C=O)=N1Description: Gemfibrozil PMID:23664186
Product Name : Manganese(IV) oxide activated, tech. 90%Synonym: IUPAC Name : dioxomanganeseCAS NO.:1313-13-9Molecular Weight : Molecular formula: MnO2Smiles: O==ODescription: Manganese(IV) oxide is suitable for use in batteries.Laccaic acid A It…
Product Name : Dimethyl allylphosphonate, tech. 85%Synonym: IUPAC Name : dimethyl (prop-2-en-1-yl)phosphonateCAS NO.:757-54-0Molecular Weight : Molecular formula: C5H11O3PSmiles: COP(=O)(CC=C)OCDescription: Flecainide acetate Romidepsin PMID:23775868
Ant lung cancers that lack the second-site EGFRT790M mutation. Cancer Discov 2012; two: 92233. 27. Guix M, Faber AC, Wang SE, Olivares MG, Song Y, Qu S et al. Acquired…
Was about 38 molecules per square micron. Under N-sufficient conditions and high-ammonium pressure, the density decreased to about 31 molecules and about 13 molecules per square micron. Inside the chc2…
Ty of breast cancer has been the topic of considerably investigation in the past decade, and emerging evidence has indicated that the tumor microenvironment plays a pivotal part in driving…
Analyte. The production of VSCs in humans is ascribed towards the metabolization of the sulfur-containing amino acids methionine and cysteine in the transamination pathway . In liver thiol S-methyltransferase forms…
8,9]. Recent investigations indicated that the inflammatory and stress responses pathways are highly integrated and they work most-likely in vicious cycles, which largely explain the myriad of disorders associated with…
Diments, for example those at fish farms, or have been provoked by organic enrichment , and also by complex humic compounds . The abundant decomposing organic matter and oxygenic bacteria…
0.012 mol), EDCI (1.86 g, 0.0012 mol), and HOBt (1.62 g, 0.0012 mol) had been added, and the mixture stirred at 0 for 30 min. A remedy of 5-methoxy tryptamine…
Ture to become in close proximity to myr-UDP-GlcN. Phe-192 is known to contribute 3 kcal/mol of free of charge power to product binding, and mutation of this residue to alanine…
L activity in the every plant extract. The plant extract residues (50 mg) were re- dissolved in 2.five ml of ethanol, sterilized by way of Millipore filter (0.22 mm) then…
Data over the past decade. Group II in the GRETCHEN HAGEN3 (GH3) family of acyl amido synthetases conjugates IAA to amino acids (Westfall et al., 2010). Recent crystal structures of…
Is (Fig. S1D), and phagocytosis of nuclear material by mature neutrophils (LE cells) (Fig. S1D, inset) or other cell forms (Fig. S1B, inset). A lot of LE cells had been…
Ere measured in blood samples with an auto-analyzer (7180; Hitachi HighTechnologies Co., Ltd, Tokyo, Japan) working with kits (TGL: M/PM; T-cho: L M/PM; HDL cholesterol : L M/2-PM; CRP: LT-HS…
Behavior to facilitate processive catalysis. This investigation is amongst the few reported examples of a course of action where the dynamics of a substrate are vitally vital.INTRODUCTION MD is of…
Contaminations, standard procedures were taken.30 The resulting sequences had been then analyzed employing the BioEdit software.31 Before tree construction, the best-fitting substitution model was selected employing jModeltest depending on the…
Was achieved by the excitation sculpting scheme (36) plus the water-selective 180Sinc shape pulse was 3 ms lengthy. The data had been collected with a sweep width of 9157 Hz,…
Ximal binding capacity Bm was decreased considerably (p 0.05), becoming equivalent for the albumin concentration (238 90 for 1:2 and 48 18 for 1:10 dilution). M MToxins 2014,Fitting models (Equation…
Scular deaths . Important overall health advantages are linked with fish consumption which includes decreased danger of cardiovascular disease (CVD) . However, fish intake remains low in the U.S. Per…
Target gene NRF2 in E2-induced breast cancer and its prevention by antioxidant vit C. Components and methodsTreatment of animals Female ACI rats (4 weeks of age; Harlan Sprague Dawley, Indianapolis,…
Exactly the same genetic lineage of Myotis lucifugus employed for the Ensembl genome project. The bat was euthanized as outlined by the approved protocol after which the ideal and left…
CDCl3) 1.41 (s, 3H), 1.57 (s, 3H), 1.63.73 (m, 4H), 1.75.85 (m, 1H), 2.05.17 (m, 2H), 2.66 (d, J = 16.4 Hz, 1H), 2.79 (d, J = 16.4 Hz, 1H),…
D the Bcl-2/Bax ratio, which showed an expression shift to pro-apoptotic Bax. Numerous authors have shown that cells with overexpressed Bax, at the same time as cells possessing Bcl-2 deficiency,…
Metformin was performed using the multiple reaction monitoring (MRM) mode, based on parent/product ion transitions 130/71. Compounddependent parameters such as declustering potential, entrance potential, collision energy and cell exit potential…
G hybrid solid-phase extraction (SPE) purification coupled to high-temperature gas chromatography-mass spectrometry (HTGC-MS). Methanol-based hybrid SPE elevated the selective extraction, and HTGC resulted inside a good chromatographic resolution for the…
,b 4547 467 2820 635 a 5507 1203 4641 859 a,b 5254 712 5288 439 b 0.370 145 613 570 10,194 5630 * 242,302 126,184 a,b,* 506 179 9683 7214…
D into the low resolution SANS model restricting the search to the part of the model that was not filled by the tRNA density using SUPCOMB. The normalized spatial discrepancy…
Xcision repair (191). RecJ functions as a 50 0 ssDNA-specific exonuclease to create a extended 30 ssDNA for strand exchange with homologous double-stranded (ds) DNA in recombination, or to generate…
That heat pressure resulted only within the release of (E)-2-hexenal, although wounding triggered emissions of (Z)-3-hexenal, (Z)-3-hexenol, and (E)-2-hexenol (Loreto et al., 2006). In addition, Bai et al. (2011) demonstrated…
Gidda1, Samantha C Watt1, Jillian Collins-Silva2, aruna Kilaru3, Vincent arondel4, olga Yurchenko5, Patrick J horn6, Christopher n James6, David Shintani2, John B ohlrogge7, Kent D Chapman6, robert t mullen1, and…
Cord neurons by way of CXCRTo dissect the synaptic mechanisms underlying CXCL1-elicited discomfort, we investigated the influence of CXCL1 on spontaneous EPSCs in lamina IIo neurons of spinal cord slices.…
Arges Quick publication on acceptance Inclusion in PubMed, CAS, Scopus and Google Scholar Study that is freely obtainable for redistributionSubmit your manuscript at www.biomedcentral/submit Vascular hyporeactivity to vasoconstrictors occurs through…
Ng the UV2800 ultraviolet spectrophotometer (UNIC, NY, USA) with A260/A280 ratio among 1.eight,2.0 and RNA concentration was ranged from one hundred ng/ml to 1 mg/ml. GeneChip Human Exon 1.0 ST…
Ion of neutrophils; therefore their agonists are conventionally termed "chemoattractants". It need to nonetheless be stated that the majority of these ligands (in particular formyl-peptides, lipid mediators and C5a) also…
Tel.: +82-2-3408-3233; Fax: +82-2-3408-4320. Received: 18 April 2013; in revised type: 7 June 2013 / Accepted: 13 June 2013/ Published: 20 JuneAbstract: The classes and concentrations of volatile organic compounds…
.0085576.gadditional targets that influence its capability to operate synergistically with phenformin.Impact of Phenformin and Oxamate Combination on ROS, ATP, and DNA DamageInhibition of complicated I is expected to raise superoxide…
Stis jirovecii can be a symbiotic respiratory fungus that causes pneumonia (PcP) in immunocompromised individuals, like those with AIDS. Within the United states, the incidence of PcP in HIV-infected populations…
Olutionary procedure for activity in blood are shown as white diamonds. Silent mutations are underlined.and pGAPZA under the control in the constitutive glyceraldehyde 3-phosphate dehydrogenase promoter (PGAP) (Figure two). Transformed…
Doglin physically interacts with each ActRIIA and BMPRII, that the kinase activity of neither receptor is expected, that the tail domain of BMPRII is just not essential, and that the…
Interactions on lymphocytes, despite the fact that the molecular mechanism remains unknown. We propose that HA degradation items developed during CNS inflammation by hyaluronidases or other mechanisms, might function as…
Lactin-3 StainingGalactin-3 (gal-3; MAC2) is usually a b-galactoside-binding lectin current during the nucleus and cytoplasm; it's been linked on the behavior of colon cancer cells with down-regulation noted with tumor…
Deficient of genes in nonclassical NF-B pathways including NIK, IKK, and RelB had abnormal thymus advancement with decreased UEA1+ and/or Aire+ mTECs . p52 deficiency outcomes in much less considerable…
400000 cm21) on Perkin lmer FT-IR spectrometer. 1H and 13C NMR spectra were recorded on Jeol JNM-LA400 FT-NMR program (Figures S1and S2). TMS was applied as an internal typical and…
The bloodstream and brain may possibly vary as outlined by geography, fish availability, and also other dietary habits. Finally, experimental research may be performed in either animal models or in…
Conclusions (Mayshar et al., 2010; Ben-David et al., 2011; Ben-David and Benvenisty, 2012b). As both research and clinical usages of PSCs rely on mass production of differentiated, functional, karyotypically standard…
Ice even though the supernatant was carefully aspirated, paying attention to not eliminate any erythrocytes in the interface. The erythrocytes had been resuspended in 0.15 mL of ice cold ultra-pure…
Variations within the lag time among the 96 wells would deliver insight into the mechanism underlying fibrillation. The lag time depended drastically on GdnHCl, using a minimum at two.0 .0…
Area but is just not necessary for potency. 3 new derivatives (46-48) were prepared from offered pyridyl or pyrimidyl developing blocks (38 and 39) working with an analogous series of…
Illumina Sequencing and Mapping DGE Tags to TranscriptomeTwo DGE libraries of P. xylostella were sequenced including the treatment and handle which generated among 7.16 and 7.53 million raw reads for…
Sfer model, by contrast, is initiated by the stimulation of activated CD4 T lymphocytes to produce IFN and IL-17. In spite of these diverse causes, we located that the effects…
L III). Photos were obtained 72 h post injection. a Coronal image of main tumor. b Coronal image of lymph node metastasis inside the neck. c Sagittal image of major…
D interactions. In hepatocytes at day 1 of culture, one hundred mM silymarin, silybin A, or silybin B significantly inhibited E217G and rosuvastatin transport. These concentrations have been above the…
Trifugation can mechanically perturb and remodel lipoproteins. For instance, in our operate, the total LDLs were isolated from human plasma by ultracentrifugation, followed by an additional round of ultracentrifugation to…
Arumuganathan (Benaroya Analysis Institute) for specialist technical assistance and Aimee Schantz and Amy Look for administrative support.Supplemental DataSupplemental material for this short article might be identified at http://dx.doi.org/10.1016/j.ajpath.2013.05.009. The coral-Symbiodinium…
From human malaria infections in South-East Asia .Fitness and Remedy Implications of Slower Clearance Rates in Malaria ParasitesFigure 4. Dynamics of asexual and transmission stage parasites in single and mixed…
Escribed. two.4 LC-MS/MS of Patient Sample Pools To recognize CLIC and TPM isoforms and family members that could possibly be detected in ovarian cancer patient sera, label-free comparisons of pooled…
. SCs had been resuspended in 400 ml Annexin V binding buffer and incubated with two ml Annexin V-FITC at room temperature for 15 min, then 5 mg/ml (final concentration)…
Nosis are still unknown. The limited variety of individuals in the literature have presented in various clinical stages and received different remedy combinations therefore the data summarized within this overview…
Additionally, other individuals have reported an acceptable security profile for AAV1-mediated gene delivery in human clinical trials (Brantly et al., 2006; Mendell et al., 2010). As such, we initiated a…
Zole at which no development was observed when two l on the second dilution (i.e. 106 cells/ml) in the culture was spotted onto plates containing ketoconazole (28). Ketoconazole Accumulation by…
Omposition of Reaction Item Under the above optimal circumstances, the reaction was performed as well as the composition with the reaction mixture was analyzed. The results are listed in Table…
Ribution for every single temperature replica divided by the amount of particles within the system for the OPLSAA force field with CABS-generated starting conformations.two.2. Secondary Structure Propagation at 300 K…
Egulator of cell volume . Chloride ion efflux prevents cell swelling in hypotonic media . The decrease chloraemia observed in the balanced group could have improved the phenomenon of chloride…
Area at AN8741.2 locus encodes a putative C2H2 zinc finger domain transcription element. The revertant mutation in RM7 occurred at AN8741.two, designated as mtfA gene. B) Amino acid alignment of…
Oved by the Medical University of South Carolina (MUSC). Administration of Calpain Inhibitor SNJ-1945, a 3rd generation water-soluble calpain inhibitor was utilized (Oka et al. 2006). Mice received oral gavage…
Rst-lineprimarytherapy;(b)forindividualstoofrailfor anesthesia;(c)forthosewhodeclinesurgery;(d)preoperativelyto assuremaximalsurgicaloutcomes(109);(e)postoperativelyfor persistentandinevitabledisease;(85)or(f)whileawaitingradiotherapyimpacttomanifest.BiochemicalcontrolbyprimarySRLTheJournalofClinicalInvestigation http://www.jci.org Volume119 Number11 Novemberscience in medicineUsingconventionalassays,GHlevelsappeartoincreaseafterdrug administration,likelyduetoattenuationofnegativeIGF1feedbackonsomatotrophsecretion. Efficacy.In177patientsreceivingdailypegvisomantdosesof 100mg,76 achievednormalIGF1levelsafter24months(123), withimprovementofsymptoms,includingsoft-tissueswelling, perspiration,cardiomyopathy,andheartfailure(S38).In75 of patientsresistanttomaximalSRLdoses,pegvisomantnormalizedIGF1levelsandimprovedcardiovascularriskmarkersand insulinsensitivity.PegvisomantisadditivewithSRIFanalogsin controllingIGF1levelsinpatientsresistanttoSRIFalone.In26 patientsreceivingmonthlySRLs,additionofweeklypegvisomant injectionsnormalizedIGF1levelsin95 ofpatients(S39).Therefore, longerdosingintervalsandcombinationtherapyoffereffective pharmacologiccontrolforanoverwhelmingmajorityofpatients. Side effects.About5 ofpatientsreceivingpegvisomantdevelop upto3-foldormoreincreasedhepatictransaminaselevels(123), andthisisinvariablyreversible.Othersideeffectsincludeinjection-sitereactionsandlipohypertrophy,likelyreflectinglocal…
And also use an ASEindependent mechanism to communicate ploidy. In our existing study to dissect the C. elegans sex determination signal and uncover the molecular mechanisms by which little variations…
Tal RNA was applied as a template for cDNA synthesis primed by random primers applying the Higher Capacity cDNA Reverse Transcription Kit (Applied Biosystems, Foster City, CA, US). cDNA was…
LOS 1 | www.plosone.orgVacuolar ATPase and Magnaporthe Developmentof development defects upon loss of V-ATPase activity . Except for particular tissue-specific isoforms, systemic V-ATPase genes are even critical for the survival…
, signaling a will need for improved safety with the procedure . Concerning the exact same time, Bleyer et al. reported a successful transplant just after mixture chemotherapy without the…
A complex that phosphorylates the NFB inhibitor IB. Phosphorylation on the cytoplasmic NFB/IBNIH-PA Author Manuscript NIH-PA Author Manuscript NIH-PA Author ManuscriptBiochim Biophys Acta. Author manuscript; readily available in PMC 2015…
On levels of various adipogenic markers, including C/ebp, Ppar, fatty acid binding protein 4 (Fabp4), and fatty acid synthase (Fasn), had been decreased in Abhd15-silenced in comparison with control cells…
Hese MLLENL-IBKD mice showed a marked enhance in immature Gr-1lo c-Kithi cell populations (Figure 6D). Constant with this modify, we discovered that these leukemic cells had a greater CFC capacity…
HP HRP i.p i.v mAb mAb NMJ OPD PBS RBCs RI-BoNT scFv Ahmad et al. Journal of Hematology Oncology 2013, 6:77 http://www.jhoonline.org/content/6/1/JOURNAL OF HEMATOLOGY ONCOLOGYRESEARCHOpen AccessInhibition of Hedgehog signaling sensitizes…
Atches of 100 size-matched islets have been washed as soon as in serum-free RPMI medium and cultured in noncoated 6-well plates (Falcon) for 48 h. For protease inhibition studies, the…
Ollowing tail-vein injection of PF-04457845 and decapitation at a variety of time points, trunk blood was collected and total radioactivity in the plasma was analyzed by radioHPLC . At two…
R basement membrane-proteoglycans accompanying loss of anionic web site staining in experimental diabetes. Lab Invest 1989;61:202-11. 14. Pourghasem M, Aminian N, Behnamrasoly M, et al. The study of glomerular volume…
Uscript NIH-PA Author ManuscriptToxicol Appl Pharmacol. Author manuscript; available in PMC 2015 September 15.Gilbert et al.Pageconjugated polyclonal goat anti-mouse IgG (1:4,000). Densitometric evaluation of mouse myeloma IgG run in adjoining…
Tively, as previously described (15, 16). -fetoprotein was detected by industrial quantities Enzyme linked Immunosorbent Assay kits (ConAg, Sweden) in line with the manufactures' instructions.3.4. 2-DEBriefly, around 100 of proteins…
Effect of HIV infection on the brain. The contribution of loved ones, social and economic things on neurodevelopment is nonetheless complicated and our study did not execute in depth evaluation…
Followed via week 72.Model structureWe made an Excel-based (Microsoft Corp., Redmond, Washington) Markov model to project health-related outcomes and to estimate the expected fees and top quality adjusted life-years (QALYs)…
Ation capacity of a dividing cell necessarily has S 1. Proof (by contradiction). In this case, the program is constrained by P the equation vjxj rS dD, exactly where r,…
He two studied groups (Lubianka and Starograd gdan ki meadows). as a result, 10 out of 69 compounds have already been located to become statistically substantial within two groups (p…
000. GM was supplied with facts about participating STAR websites along with assurance that procedures related with participating in the trial will be covered financially. Equivalent corporate collaborations have been…
Hich assistance fast cell proliferation and present a growth benefit over normal cells . Preceding acquiring suggest that lactate, the end of product of glycolysis, is produced in big amount…
Our. Cells had been fixed, stained with Filipin and imaged. Bar = 10 mm. Representative photos of three independent experiments are shown. doi:10.1371/journal.pone.0102026.gpLKO.1-puro Non-Mammalian shRNA Control Transduction Particles; Sigma). Cells…
, 3012 Bern, Switzerland; and dZentralinstitut f Ern rungs- und Lebensmittelforschung, Research Center of Nutrition and Food Sciences, Technische Universit M chen, 85350 Freising, GermanyEdited* by H. Ronald Kaback, University…
Nding domain as E2, and disrupt regular ER cellular function.four,5 A key structural feature of E2 will be the presence of two hydroxyl groups that are separated by 11 which…
Outcome from differences in viral antigen burden. Rather, depending on their differing responses to anti-PD-1 mAb remedy, we hypothesize that these mice differed in the quantities of HIV-specific CD8+ T…
Ts, essentially the most recent AASLD suggestions propose that adults with Child-Pugh score class A cirrhosis and resectable small tumours ought to undergo resection as opposed to ablation15053. Transarterial embolization…
Ch et al., 2008; Turnbaugh et al., 2010). Gene expression from microbial assemblages has been correlated with biogeochemical data and also the phylogeny of expressed genes affiliated with certain populations…
That repression of virus expression, particularly by p30II, might enable for evasion of immunodestruction of virus infected cells along with a higher probability of T-lymphocytic transformation . Further,epidemiological research would…
Ically, by correlating their single-nucleotide polymorphisms (SNPs) and copy-number variants towards the distinctive mating systems of various primate species (Jensen-Seaman and Li 2003; Kingan et al. 2003; Dorus et al.…
Ide to give the target compound. Structures have been confirmed applying melting point, NMR, and MS tactics. The target compounds are: 2-phenyl-N-(2-(piperidin-1-yl) ethyl)bicycloheptan2-amine (5a), 2-(4-fluorophenyl-N-(2-(piperidin-1-yl) ethyl)bicycloheptan-2-amine (5b), N-(2morpholinoethyl)-2-phenylbicyclo heptan-2-amine (5c),…
Pathways. Akt and AMPK signaling have been identified as active and inactive, respectively. As these pathways have an opposite role on mTORC1 signaling, we set out to inhibit Akt kinases…
In 1 (CD29), at the same time as HRPconjugated goat anti-mouse IgG, and goat anti-rabbit IgG have been obtained from Santa Cruz Biotechnology, Inc.; antibodies against phospho-p38 (Y182/T180; pp38Y/T), phospho-Ezrin…
Further been used in wound healing, as an antiulcer agent and as an anti-inflammation agent . The aerial parts of A. millefolium are usually applied as aqueous or alcoholic extracts.…
Genesco-phagocytosis of F. novicida with exogenous S. minnesota LPS resulted in caspase-11 activation (Fig. 3D). With each other, these outcomes suggest that Francisella species evade caspase-11 by modifying their lipid…
D. The instrument was interfaced to a perform station running AnalystTM version 1.five.two application and all data generated was captured and stored on the perform station's really hard disc drive.Preparation…
D The Worshipful Enterprise of Pewterers.Reference List1. Sutton MA, Wall NR, Aakalu GN, Schuman EM. Regulation of dendritic protein synthesis by miniature synaptic events. Science. 2004; 304:1979983. 2. McKinney RA,…
Loride) that was replaced with corn flour (Table 2). The amount of salt chosen for the handle diet is the fact that frequently located in commercial dry cat foods. The…
SFs and SGs) might exhibit anti-inflammatory activities, as observed by in vitro and in vivo experiments (Borsig et al., 2007; Cumashi et al., 2007; Melo-Filho et al., 2010; Belmiro et…
Enger ejection , which is boosted by mismatches or G wobbles in the seed region (positions two or 8 with the guide strand) or the 30 -supplementary region (positions 125…
From infected wounds are collected. The following step normally employs an "enrichment" method whereby the target bacterial species is added to the sample to boost the titer of phages infective…
Dietary effects on male or female offspring underpins quite a few diverse nutritional interventions that have explored developmental programming . To our understanding, none are as marked as presented right…
Has not been reported before. The truth that PN itself degrades more than time in MS media should be of interest to researchers studying mutants with defects in vitamin B6…
Leared by CYP3A. Finally, two research weren't integrated in the table due to the fact age ranges were not reported: one particular showed no association among age and ritonavir-boosted fosamprenavir…
Ed saline with Tween 20), and also other buffers have been as described preJOURNAL OF BIOLOGICAL CHEMISTRYHARE-mediated Gene Activation Is HA Size-dependentviously (31, 38) Compete Medium contained DMEM supplemented with…
Earts had been sliced into 1-mm-thick transverse sections and incubated in triphenyltetrazolium chloride answer (TTC, 1 in phosphate buffer, pH 7.4) at 37 for 15 minutes then fixed in 10…
NA sequence c.176_178del c.179GT c.181CA c.182AT c.182AG c.183AC KRAS exon four BRAF exon 11 BRAF exon 15 c.436GA c.1397GA c.1799 TA c.1808AG PIK3CA exon 9 c.1624GA c.1633GA c.1635GT c.1636CA PIK3CA…
Nd we hypothesize that the exact same is true for engineered OPAAH activity. Millard and colleagues originally proposed the spontaneous reactivation of G117H was acid catalyzed and might involve a…
FITCAnnexinV and PI were added for the fixed cells for 20 min in darkness at space temperature. Then, Annexin V binding buffer was added for the mixture just before the…
Ata not shown). Once more, this suggested that mechanical stretch induce far more prominent effects on undifferentiated C2C12, around the early phase with the culture, than on later time points…
Oliferatoractivated receptor c analogues significantly increases nitric oxide release from pulmonary endothelial cells and enhances calcium-dependent nitric oxide release from umbilical vein endothelial. Prior studies also reported that PPAR-c ligands…
Ction of CeHRG-1 or HRG-1 in isolation, they overexpressed the genes in hem1 mutant yeast cells, which don't express HRG-1 proteins and, despite a lack of endogenous heme synthesis, absorb…
Al mechanisms, which includes advanced glycation finish product (AGE) formation, elevated polyol pathway flux, apoptosis and reactive oxygen species (ROS) formation (25). Our final results showed that sesame therapy could…
PA Author ManuscriptSupplementary MaterialRefer to Internet version on PubMed Central for supplementary material.AcknowledgmentsWe thank Britni Arlian and Jessica Lu for technical assistance and Anna Tran-Crie for assistance in preparation on…
Wn the de novo synthesis of fatty acids and TG but in addition inhibit the differentiation of early differentiating preadipocytes and lipogenesis in mature adipocytes. The serine/threonine kinase Akt is…
8+ naive cells (CD8+ CD45RA+) were not correlated with CMV titers (Figure 3B; not considerable, P = 0.53). As opposed to inside the previous larger study , we didn't uncover…
Th (19), As immune cells microglia scavenge apoptotic cells, tissue debris right after trauma, or microbes (19). They are able to also act as scavengers of extracellular molecules for instance…
G HIIJ0 six 0 40 *294 6/29(0 *4*20 48=0 74 490 ";,*0 7,*0 B56K50 40 48=4*=0 *24 ;28 0 54 0 (two 0 ,0 L20 2 4L96 52=D0 M2 2K…
Andak et al.PROTEIN SCIENCE VOL 22:486--we applied far more than 1.0 mL, and hence we determined the most beneficial application volume to become 1.0 mL. For a 2-mL spin desalting…
Ts are aerobic Strepcoccus and anaerobic Streptococcus intermedius. Additionally, it truly is relevant to mention that it can be quite uncommon to isolate Streptococcus pneumoniae in spite of the bacteria…
Mains, and correlated with movement in between a perinuclear compartment, adhesions, plus the plasma membrane.image analysis motion classification protein engineering rapamycin||| live cell imaging |ince its discovery, c-Src (1) has…
Tamate cysteine ligase catalytic subunit, and glutathione synthetase) and schizophrenia in Japanese people (Hanzawa et al., 2011). Suboticanec et al. (1990) reported that each plasma and urinary vitamin C levels…
DNMT2 methyltransferase. Biochemistry 2012, 51, 4438444. Jones, P.A.; Baylin, S.B. The epigenomics of cancer. Cell 2007, 128, 68392. Berdasco, M.; Esteller, M. Aberrant epigenetic landscape in cancer: How cellular identity…
0.five M NaCl, Gag nonetheless binds Psi RNA (Kd = 300 nM), whereas no binding was observed to TARPolyA (Fig. 2A,B). NC showed robust binding to Psi RNA at 50…
KCNQ2 mutations. On the other hand, in contrast to BFNE, the interictal background EEG was altered and displayed multifocal spikes or even a suppression-burst pattern. The ongoing epilepsy and development…
E Tu-2449 control cells than Tu-2449 STAT3 knockdown cells had passed through the matrix (100:20, P , .05) monitored right after 16 h (Fig. 2B). Taken with each other, these…
A important reduction of leukemia cell growth as revealedCatalani et al. Journal of Experimental Clinical Cancer Analysis 2013, 32:63 http://www.jeccr/content/32/1/Page 4 ofby the vital dye trypan blue (Figure 1A). The…
The non-redundant SILVA SSURef102 as the starting database. Inside the final iteration, 12 032 paired reads (0.05 ) have been reconstructed into 16S rRNA gene sequences. Sequences had been clustered…
Plemental material). Viral lytic genes of each transcriptional class have been observed from TB40/E-infected monocyte/fibroblast cocultures (Fig. 1F, lanes 1 to six, 7 to 12, and 13 to 18). Interestingly,…
Aken at a fasted state prior to (day 1) and soon after (day 8) the challenge. Paired t-test analyses have been utilized to assess the change in variables just after…
R processing. The chosen genes have been further filtered primarily based around the number of cancer hallmarks related with them. Genes which had been linked with at the very least…
://www.diagnosticpathology.org/content/8/1/Page 5 ofTBARS ( ol/L)Figure 4 Correlation involving serum total homocysteine (tHcy) and TBARS levels in patients with AMI (r= 0.four, p0.001).xanthine oxidase activity beneath ischemia reperfusion . Other enzymatic…
Corbate peroxidase action with "chloroplast dormancy" is proposed. Most importantly, the power and substrates essential for the substantial metabolic remodeling that's a hallmark of freezing acclimation may very well be…
That contained a ten cm extended silk thread in its lumen and filled with heparinized saline (30 units g-1). Blood circulation was started by means of the shunt, initiating thrombus…
Of 9-R-HODE or M 13-R-HODE also substantially enhanced the expression of CXCR4 at this time point (Figure 3D). Of note, 9-S-HODE was without effect and also the improved expression observed…
To N which interact with oxygen species according Fairbrother's works53. Figure 4b and 4c show Pt 4f spectra of intermetallic Pt3Fe1/C and Ncontaining intermetallic N-Pt3Fe1/C, respectively. Every single Pt 4f…
Temperatures (30, 40, 50, 60, 70, 80, and 90 ) for 45 min and stopped by incubating at one hundred for 10 min, then used for titration assay. Reaction mixture…
Eversed by HDAC inhibition and quite a few HDACs have already been implicated as repressors of BRM transcription . Interestingly, we located that inhibiting the ERK1/2 pathway with MEK or…
Noparticles, like in vivo assembly of RNA arrays ; nanostructures made of bacterial noncoding RNA ; RNA triangle assembly guided by proteins ; construction of RNA squares and hexamers (Shu…
GYIMGDRSVNEFKFSECSKKCVKYALSLPEAKCVYESCGF GGNFWKIETRSKMMFGIWILCGTAFFYCHVDAFMEYSNMVPGYNALIRRSQKEPWWKGRMFDNLGYNQAYLVKRNF DEIDNVGFNDFGPGTGRSWLPKRNLELASYNSRRLRL TTMIYLASIFLFAIASAIPSGRVDVVFPSVETSRSGVKTVKFRALNEEIELKLEPAGE ID/Genbank quantity JZ122324 JZ122323 Ct69, putative hypothetical protein, partial Ct70, putative unnamed protein item, partial Descriptor Amino acid sequence MQLLLLTCLLQLIMVTNKAIASQISQIKHFFHCILVVVCPNSSMYLIMSGS QICLRPRCWIRFPLFRKRNKKGVCSTHENLHDLSSNRREPGWFLS JZ122316 JZ122317 JZ122318 JZ122319 Ct62,…
Ntly affect our calculations of mutation rates or mutational spectra. DISCUSSION The mutation price in the absence of mismatch repair Mutations in mismatch repair proteins, among the strongest elevators of…
G mL21 of artesunate, quinine, primaquine phosphate, chloroquine diphosphate salt, pyrimethamine, or lumefantrinepetitive InhibitionThe optimal concentrations of coating antigen, mAb, and peroxidase-labeled goat anti-mouse IgG were screened by checkerboard titration.…
. Combining all three substitutions (7) benefits in 250-fold larger affinity than the original /-peptide 1. Every single variant of 1 retained higher affinity for Bcl-xL, though pretty compact decreases…
Y disrupt the neuronal systems of C. elegans by means of a equivalent mode of action. In conclusion, we showed that exposure to particular phthalates (DEHP, DBP, and DIBP) induced…
On of imatinib was not dependent on NOS or NO release or tonic nerve activity inside the cavernosal nerves. The IC injection of imatinib decreased the MAP at all doses…
By tuning down effector activities or blindingthe immunesystem from recognizing them. An effective immune response against tumor relies on fine orchestration of various elements in both the innate and adaptive…
In which a variable has been modified, within this case the concentration of O3. A related strategy utilizing differential international profiling was reported previously, nevertheless it only compares two sets…
, also because the connected dosage adjustment were described previously. This study was approved by our institutional ethics committee, and written informed consent was obtained from all sufferers in accordance…
And repression8 of transcription, manage of alternative splicing21, regulation of worldwide chromatin structure22,23 and handle of protein synthesis24. Our information recommend that co-repressor recruitment to DNA is actually a core…
In the buffy coat from 500 ml human whole blood (courtesy of your blood preservation, University Healthcare Center Mainz, Germany). For separation on the cytosolic and membranous fraction, we utilized…
Tic activity in the enzyme, implicating that the ligand-induced conformational alterations, or induced match, is definitely an critical a part of the catalytic mechanism.Further enzyme-ligand interactionsAs a result of the…
Ar, the pathways and mechanisms involved in these outcomes may not be precisely the same . Furthermore, vital differences arise depending on the animal model used, the duration in the…
All participants. The detailed demographic information are summarized in Table I. Gear and therapeutic regimens. A minimally invasive, targeted argonhelium cryoablation operating method was applied, which comprised an argonhelium cryoablation…
TGCGTGTGTGTGTGTGTGT R: TAATGTGTTGGGAGGTGCAA F: TGGGTCTTCTTTGCTGTGTG R: GGGAAGACGTTGGGCAATCACT F: GTCGTGACTGGGAAAACCCTGGCG R: TCCTGTGTGAAATTGTTATCCGCT F: ACATATATACCCCGCCAACG R: CTCCTCGCCCTTGCTCACCATGCCGCCGCCGCTGCTCTCCTGGACCTT F: TCCTGTGTGAAATTGTTATCCGCTATATCCGCCAGTAAACTCTGAG R: AAGCGGATTGGGTCTTCTTT F: TTCTCACCCACTCCTCCAAC R: AACGGCTTGAAATGGACAAC F: CTCCACATCAGCCTCCATCT R: CTCCTCGCCCTTGCTCACCATGCCGCCGCCCCTGACGCAGTAGCCACCGT F: TCCTGTGTGAAATTGTTATCCGCTACGTATCGTTCCGCAAGGCC R:…
Plex, NMR, UV-Vis and fluorescence spectroscopy based evidence support intercalation because the dominant binding mode at low TSMC/HT ratios. The structural model created utilizing docking and MDs simulations confirmed that…
Expression of SelSFigure 10. Immunofluorescence of endogenous SelS following siRNA remedy in HepG2 cells. HepG2 cells have been treated with individual siRNAs as indicated. Immediately after 72 hours the cells…
Zation of TB suspects in TB clinics from south Texas and northeastern Mexico have been described previously.20 For this study we identified 32 culture-positive TB sufferers who were HIV-negative and…
Rticle is published with open access at SpringerlinkAbstract Undesirable butter-tasting vicinal diketones are produced as by-products of valine and isoleucine biosynthesis for the duration of wort fermentation. One particular promising…
Mponents named as pTACs (pTAC1 to pTAC18; Pfalz et al., 2006). Highly purified soluble RNA polymerase preparations from tobacco (Nicotiana tabacum) and mustard have already been shown to include 13…
Ed CD4+CD39+ T lymphocytes and CD392CD73+ U-87 MG/T98G glioma cells was confirmed primarily based on a carboxyfluorescein succinimidyl ester (CFSE) labeled CD4+CD392 responder T-cell proliferation assay. Of note, pretreated with…
E erlotinib-resistance (H460), supplying a rationale for testing the mixture in patient populations identified to be resistant to erlotinib alone. Further there's no a priori reason why a chemosensitizing effect…
Ytes. This premature differentiation also results in a reduce in proliferation, a progressive decline in chondrocyte production over time, and in the end a delay in bone development. These findings…
R abnormality in XLI provokes small epidermal hyperplasia or inflammation. This minimal pathology is supported by molecular assay research that show pretty couple of genes are altered inside the epidermis…
Omedcentral/1472-6785/13/Page 4 ofN. limnetica diet. Only 40 of exposed animals have been infected, which can be a 6-fold reduce (odds ratio) compared to the S. obliquus diet ( 80 ).…
T.; Harkin, D.G.; Chirila, T.V. Human corneal endothelial cell development on a silk fibroin membrane. Biomaterials 2011, 32, 4076084. Bray, L.J.; George, K.A.; Hutmacher, D.W.; Chirila, T.V.; Harkin, D.G. A…
CH Study Group. Search for Diabetes in Youth: a multicenter study on the prevalence, incidence and classification of diabetes mellitus in youth. Manage Clin Trials 2004;25:45871 Ingram DD, Parker JD,…
Ulate, had lentiviral sequences in DNA extracted from the transplanted testis but not inside the DNA from the sham-transplanted testis. Sperm counts in all of the monkeys had been assessed.…
Ther Src regulation or caveolin-1 expression. Expression of A420P Mutant Inhibits Ouabain-induced Activation from the Src Pathway--We have shown that ouabain can be a specific agonist of 1 Na/K-ATPase Src…
MnSOD knockdown (KD). No substantial adjustments had been observed in ECAR values. (B) Both MitoQ (0.1 M) and L-NAME (50 M) blocked the enhance in LR mtDNA and mtDNA copy…
two 2.34/2.72 two.26/2.36 1.97/2.H30 four.three 4.75 4.97 4.96 5.03 4.96 five.10 five.00 4.91 four.77 four.81 4.85 4.86 4.96 four.95 5.03 five.03 five.09 5.00 four.87 four.73 4.H40 4.23 four.44 four.40 four.49…
Rtienssen, 2007; Popova et al., 2013). Lastly, on the 133 recognized genes derepressed in vim1/2/3, 39 were expressed at a low level all through improvement but their expression was markedly…
Croptosis proceeds via a RIP3-dependent phosphorylation of MLKL (16, 17). To figure out the contribution of MLKL across all three RIP3-dependent necrotic death pathways, we blocked MLKL expression levels in…
Technical replicates were completed in triplicate. Co-transfection of ZEBRA with GFP into 293 cells decreased the amount of GFP mRNA by 50 . Co-transfection of BGLF5 and GFP lowered the…
Ed CRH levels could modify the sigma activity, hence escalating the susceptibility to seizures also as to abnormal sleep spindles timing. In addition, the involvement of CRH, which features a…
H Characteristics--All subjects were born at full term gestation with standard weights (, 3.4.3 Kg). All kids presented with proof of dehydration, metabolic acidosis, and diarrhea through the first two…
And vegetables, cereals and nuts has been shown to increase the total antioxidant capacity from the breastmilk . Key nutritional antioxidants involve - and -carotenes, lutein + zeaxanthin, lycopene, and…
In TNBStreated mice. Within the present study, a mouse model of TNBS-induced colitis was applied to investigate the effect of regional TGF-1 levels around the severity of colon inflammation. As…
Plantarum is usually located in plant, dairy, meat, fish, and wheat fermentation and is often a organic inhabitant in the gastrointestinal tracts of humans and animals2,135. L. plantarum is most…
Production of multienzyme complexes by some fungal strains. Approach Biochem 31:64550 Mottram DS, Wedzicha BL, Dodson AT (2002) Meals chemistry: acrylamide is formed within the Maillard reaction. Nature 419:44849 Mukherjee…
Inhibit viral transcytosis by 02.5 . Quantitation of SIV RNA plasma load The SIV copy number was established making use of a quantitative real-time PCR with sensitivities of 40 copies…
Prices right away upstream of extracellular regulated kinase 1/2 (ERK1/2) and hyperlinks to Raf and ERK via phosphorylation. Presently, small is identified in regards to the role of MEK2 within…
Genes and proteins, too as more data are provided in Supplementary Excel File S1. two.3. Phylogenetic Reconstruction MEGA 11 (v.11.0.13) computer software was applied for the phylogenetic analysis. All trees…
Ic signaling as a important occasion in E. bovis sporozoite-mediated NETosis given that theobromine therapies also led to a considerable reduction of this effector mechanism in bovine PMN. Inhibitors on…
AbotulinumtoxinA-treated animals (2U and 5U OnabotulinumtoxinA, animals. In thethe time of euthanasia), increased numbers of and 5U cells and chromatolysis irrespective of OnabotulinumtoxinA-treated animals (2U satellite OnabotulinumtoxinA, irrespective with the…
D Therapies(2022) 22:Page three ofMaterials and methodsMaterialsBioactive compounds in the stems of D. angustifolia Roxb have been prepared as reported by Zhao et al. . (2S)-4,5-Dihydroxy-7-methoxy-8-methylflavan (Compound five), (2S)-4-hydroxy-5,7-dimethoxy-8methylflavan (Compound…
Ependent mechanisms) in several experimental models of cardiovascular, renal and metabolic disease . Favorable effects connected with nitrate/nitrite treatment contain reduction of lipid accumulation, inflammation and fibrosis, which mechanistically have…
Itation of sperms, acrosome reaction, and fertilization; therefore, they're significant for male fertility . The decline in male reproductive functionality could be linked to the deregulation of mitochondrial membrane potential…
Which results in phosphorylation and activation of Akt, and p-Akt results in an increase in p-GSK-3/GSK-3 ratio. GSK-3 is definitely an enzyme whose activation is dependent on its dephosphorylation, which…
Rk should really examine these associations among women attempting pregnancy, who've a higher variability in caffeinated beverage consumption both within and outside of your recommended ranges. DNAm changes in neonatal…
Ment. Though vector transfection could, to a certain extent, sensitize PACT-/- cells to IFN- induction by EMCV, ectopic PACT expression additional elevated the magnitude of this induction (Fig. 1E), confirming…
)/height(m2). Fasting blood collections had been conducted in the morning following a 12-hour quickly along with the samples were centrifuged to acquire serum or plasma at each and every facility.…
States National Inpatient Sample database reported 6.4 circumstances per 1,000,000 inpatient prevalence of methanol toxicity (Kaewput et al., 2021). Insufficient stocking and availability of antidotes happen to be reported as…
Illin, and cefoxitin) showed resistance only to biofilm-forming S. aureus isolates. Antibiotic resistance enhanced with the amount of biofilm formation, which includes the determination of considerably larger resistance to erythromycin…
Re shown as Mean+SEM. p 0.05, p 0.001.four. Discussion In summary, our benefits show that asthmatic individuals have higher expression of TGF-RII. In controls and asthmatics, TGF- release is drastically…
Ed by this virus is composed of pro-inflammatory cytokines that explain all the indicators and symptoms on the illness, and glucocorticoids may modulate inflammation-mediated lung injury and thereby minimize progression…
D the consequence was the prolongation in the coagulation time straight correlating with PS activity in the measured sample. BCSXP (Siemens Erlangen, Germany) blood coagulometer was employed for the measurements…
E, MG QoL-15 questionnaire, MGFA-QMG, and MMT. Subgroup evaluation was then performed by stratifying individuals by onset ages (early-onset MG versus late-onset MG), MGFA classification (mild group with MGFA II…
D inflammation by inactivating MAPKs and NF-B signaling pathways and hence attenuated inflammation triggered by K. pneumoniae infection.3.six. Pharmacokinetics and Biodistribution Profile in Model Rats. e key pharmacokinetic parameters of…
Odes of metabolism which might be potential therapeutic targets and could be applied to break metabolic symbiosis.THE Part OF HYPOXIA Inside the Improvement OF TUMOR METABOLISM: Restricted OXYGEN DIRECTS THE…
+. Although p21 levels reverted to baseline by eight hours following IR in Mdm2+/+ spleens, they remained larger in corresponding Mdm25AA/5AA spleens. These benefits recommend that subtle increases in basal…
Re drawn in GraphPad Prism 8 software. Quantitative values are presented as imply normal error of imply. The statistical significance was indicated by p 0.05.RESULTSGeneral Situation of AK and WT…
-1 of dry matter (d.m.). All analyses have been performed in duplicate.Foods 2022, 11,4 of2.4. Phenolic Extracts Preparation Free of charge and bound phenolic compounds have been extracted from distinctive…
Atient enrolled on Aug 27, 2020, along with the last on Feb 10, 2022. Patient flow is presented in figure 1. Soon after screening sufferers for eligibility, in the two…
Pediatric CNS tumors, extracranial solid tumors, and hematologic malignancies . Furthermore, Nanni and colleagues proved that serial passaging of pediatric bone sarcomas, which include OS, recapitulated the morphology and the…
Tophagolysosomes (mRFP), along with the yellow spots would be the autophagosomes (mRFP+GFP). two.15. Transmission Electron Microscopy. The hearts have been reduce into 1 mm slices and fixed overnight at four…
Si can't be as robust as O , and adjacent atoms like Si/Mg usually do not require to transfer as substantially electron cloud towards the central O compared to MgO…
Uted toward conceptualization, system design and style, information evaluation and sorting, and writing, reviewing, and editing the original draft. Jingjing Cao contributed toward reviewing and editing. Shanyong Jiang contributed toward…
Compared totreatment group seizure DCA and pyruvate co-treatment group than in the seizure vehicle the seizure ehicl (Figure cells inside the seizure CA and group, the mixture seizure CA FJB…
Okyo, Japan), equipped with an ASX500 autosampler, MicroMist concentric nebulizer, Peltier cooling spray-chamber (2 C), two.five mm internal diameter torch, nickel sampler and skimmer cones. Operating situations of ICP-MS integrated…
Ity involving cohorts have been assessed making use of adjusted Cox proportional hazard models. For secondary outcomes, differences have been assessed utilizing adjusted Cox proportional hazard models and Fine and…
Pplementation of the basal diet regime with QLJP alleviated pulmonary fibrosis (Figure three).Animals 2023, 13,eight of3.3. The Impact of QLJP on the HYP Content material in Lung The content of…
ESE is really a potential antioxidant mixture against ROS. Lately, Rotta et al. obtained equivalent benefits (250 20 mg GAE/g, DW) for TPC and IC50 (19 three /mL) for DPPHin…
EvenseJohnson syndrome-induced mortality cases from 1999 to 2008 in the National Health Insurance coverage databank. Yr1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 TotalCases8 6 8 eight six…
127.7 (C-2), 115.6 (C-1), 112.two (C-1), 109.four (C-1a), 102.four (C-8), 101.9 (C-4), 101.1 (C-11a), 98.0 (C-10), 79.2 (C-3), 76.9 (C-6a), 67.9 (C-12a), 64.four (C-6), 56.7 (MeO-3), 55.9 (MeO-2), 28.7 (C-4),…
And in our prior study, proteomics have been currently skilled in analyzing antibacterial and resistance mechanism of coagulase-negative Staphylococcus.10 So, this method was suitable to discover the mechanisms of TMC.8,9…
Ncer Oral cancer Kidney cancerKidney cancerNumber of of Number Phytochemicals Phytochemicals 18 18 14 14 13 13 13 13 11 11 9Number of of Number Phytochemicals Phytochemicals Esophageal cancer six…
Vir were also considerably resolved by astaxanthin. Taken collectively, astaxanthin protects hEHTs against the toxicity of remdesivir.advancedscience in hCMs. Thus, astaxanthin appears to shield the hCMs from remdesivir-induced cytotoxic effects…
Ed, wholesome controls and remains stable more than the period of hospitalization. Second, IL38 is not related with illness severity and mortality, but we observed a constructive association in between…
Protein, fat, fiber and ash contents are inside the ranges of 35 , 1 , 102 and 21.19.3 , respectively . In this study, we found that for S. vulgare…
Ing cytolytic CD8 T cells and low expression of PD-L1, which can impair the efficacy of ICI therapy (Kline et al., 2020). We hypothesize that the level and website of…
Cells (PBMCs) had been isolated and resuspended at a density of 106/ml in ten R P M I 1 6 4 0 m e d i u m ( G…
Immunity (adenosine deaminase ADA), oxidative status (Trolox equivalent antioxi dant capacity TEAC, the ferric reducing potential of saliva FRAS, the cupric decreasing antioxidant capacity CUPRAC, uric acid, and advanced oxidation…
E images from no less than 10 fields for every sample had been acquired. Subsequently, adhesive ECs, which were surrounded by HL-60 clusters, were enumerated. In addition, fixed, labeled HL-60…
Rnal of Medicinal Chemistrypubs.acs.org/jmcArticleFigure two. Proposed intracellular bioactivation of prodrugs of five. For esterase-labile prodrugs 6-15: two-step intracellular bioactivation. Initial hydrolysis in the first ester group happens via carboxylesterases. For…
Erimental study compared clinical and antimicrobial stewardship metrics, before and just after implementation of AXDX, to evaluate the effect this technology has on sufferers with BSIs. Laboratory and clinical data…
Ze of 5.98 m with line average set to 1 and stack pictures performed in triplicates. The captured pictures had been analysed employing Bitplane Imaris application version 6.three.1 (Bitplane A.G.…
Are current or former smokers . Similarly, within a second retrospective study of real-life information from 64 individuals with extreme asthma in Turkey, tiotropium add-on to high-dose ICS plus LABA…
Ities in their naive B cell receptor repertoire (Banerjee et al., 2020). Therefore, loss of GPR84 in bats might have been advantageous by protection from excessive inflammation and adaptions from…
A better representation. - The nematode assemblages from P1A1 and P2A2 comprised greater relative abundances of microvores (i.e. H. gracilis) and diatoms customers (i.e. M. steckhoveni) with effiliated tails. Instead,…
Ctors. These consist of clinical markers for example the existence of co-morbidities,39 productive coughs65 in addition to a fever.39,65 Beyond clinical indicators, noteworthy may be the psychological distress related with…
E the risk of dementia andPLOS 1 | doi.org/10.1371/journal.pone.0277457 November 14,2 /PLOS ONERosuvastatin, vitamin D3, and form II diabetes-induced cognitive deficitscognitive decline directly by advertising the Wnt/-catenin signaling pathway .…
N web-site accumulation of inflammatory monocytes and other myeloid populations .Mechanism of action of CVCCVC is an orally bioavailable, small-molecule chemokine receptor antagonist with similar in vitro potency against cognate…
Drug interventions . Because plasma oxylipins are derived from much more abundant polyunsaturated fatty acids containing 1,4-cis,cis-Prostaglandins Leukot Essent Fatty Acids. Author manuscript; readily available in PMC 2022 May possibly…
. Phytochemical Structure Retrieval (PubChem) PubChem is an accessible chemical resource with the National Institutes of Well being (NIH). It gives data of the chemical structures, physical and chemical traits,…
Epatocellular carcinoma , which indicates that FHL2 interacts with unique partners that may possibly result in varying downstream effects. In this study, we explored regardless of whether TAB182 influences the…
L.A.; Czubryt, M.P. NF-B p65 Attenuates Cardiomyocyte PGC-1 Expression in Hypoxia. Cells 2022, 11, 2193. doi.org/10.3390/ cells11142193 Academic Editor: Guo-Chang FanAbstract: Hypoxia exerts broad effects on cardiomyocyte function and viability,…
1-KO mice compared with those in C57BL/6 mice just after alkali burn injury (N = nine). D The DCFDA ROS assay revealed that AIP1 KO notably elevated ROS production right…
Nd right away frozen in liquid nitrogen and stored at - 80 . Samples have been homogenized in RIPA buffer (FD008, Fd bioscience) supplemented with phosphatase inhibitors (FD1002, Fd bioscience)…
Ore, 40 mg GAE/L, 20 theGAE/L, ten mg GAE/L PSE and and mature adipocytes. LUT have been selected for mg subsequent experiments.20 mg/L, ten mg/L, and 5 mg/L LUT were…
Y effect. (A) To evaluate the extracellular antioxidant level of the AHextracts, the scavenging activities of DPPH radicals had been measured with different concentrations of AH extracts. Ascorbic acid (AA)…
Containing 0.8 (w/v) Bacto Agar (Difco/BD) supplemented with 0.01 (w/v) ethanol (Mock), PAC (Sigma-Aldrich), ABA (Sigma-Aldrich), GA3 (Sigma-Aldrich) or DEX (Sigma-Aldrich) upon the experiment requirement. All the plates have been…
Teins in theplasma membrane or cytoplasm are differentially regulated by transcriptional things (MYC, STAT3, TP53, and NFBIA). Interestingly, some glycoproteins in Fig. 6 are also oncogenes or tumor suppressors, which…
3 independent measurements. Drugs inhibiting CYP27A1 by 75 (the horizontal dashed line) are in bold. ND, not detectable; the limit of detection is 1 of cholesterol 27-hydroxylation. Superscripts indicate drug…
Ber 18,13 /In Vitro Generation of Functional Beta-Like CellsFig 4. Study of insulin and beta-cell marker expression inside the human H1 ES-DBCs at stage 5. (A) Flow cytometry and immunofluorescence…
Exclusion to maximize the detection of distinctive peptides. Collected spectra had been searched against the R. capsulatus protein database, which integrated the mutated CcmH and CcmG sequences utilizing Thermo Proteome…
Ulfite converted DNA was applied for methylation precise PCR with primers distinct for the derivatized-methylated and unmethylated Ogg1 gene promoter (Supplemental Table1).Chromatin immunoprecipitation (ChIP). ChIP was performed according to the…
And indirect effects via sympathetic nerve activation . In hypertension, leptin induces endothelial nitric oxide synthase expression and vasodilation by the direct action of leptin on vascular endothelial cells .…
E near pH 7 indicating that at least two ionizable groups influence the reaction. The pH dependence of kaapp for the CcP(triLeu)/imidazole reaction can be described by Eq. 4 where…
Mages were acquired and quantified by utilizing an Odyssey CLx Infrared Imaging method (LI-COR GmbH, Germany) or by using a Chemidoc XRS video densitometer (BioRad, Hercules, CA), respectively. Original uncropped…
Telligence (WASI)23; academic achievement, measured by the Wechsler Individual Achievement Test, Second Edition, Abbreviated (WIAT-II-A)24; memory, measured by the Digit Span Forward (verbal), Digit Span Reverse (verbal working), Spatial Span…
F the particle mass, TWSE, WSOC or non-exchangeable organic hydrogen concentration above plus the other half beneath. It was calculated stepwise as follows:(three)Atmos Chem Phys. Author manuscript; available in PMC…
And Infectious Illnesses on the National Institutes of Overall health under award quantity U01AI069924 (PIs: Egger and Davies). The content is solely the responsibility with the authors and doesn't necessarily…
Serious ED (IIEF score 1sirtuininhibitor0), n ( ) ED duration sirtuininhibitor3 months, n ( ) 3sirtuininhibitor6 months, n ( ) 6sirtuininhibitor12 months, n ( ) !12 months, n ( )…
Ther they acted in synergy to raise killing efficiency. This combination assay delivers a numerical worth calculated as a fractional inhibition concentration (FIC) index by measuring the successful MIC for…
Formal analysis, Supervision, Funding acquisition, Methodology, Writing--original draft, Project administration, Writing--review and editing Author ORCIDs David L Glanzman,orcid.org/0000-0001-5479- Insulin resistance is regarded as hallmark for type II diabetes mellitus (T2DM),…
Adipose tissue compartments. Male patients had drastically much more VFA plus a greater VFR than females. The fat distribution amongst CRC sufferers appears to change with age, with much more…
Monary metastasectomy. Photomicrographs with the resected lung metastasis including (C) H E staining and immunohistochemical staining for (D) epidermal development aspect receptor, (E) androgen receptor and (F) human epidermal growth…
Ence of wild sort endogenous protein is probably to result in data that happen to be difficult to interpret. Rather, wild type and loss of function mutants ought to be…
Altering Ca2induced exocytosis and its metabolic amplification. AUTHOR'S CONTRIBUTIONS LRBS, CM, HKT, and JCJ conceived the study and made the experiments. LRBS, CM, AHS, HKT, and HC performed the experiments…
Thin Gaussian0919. The molecular geometries had been optimised and also the atom-centered point charges have been calculated to fit the electrostatic potential employing RESP20. The receptor was treated by leap…
Nalysis working with Cox's regression model was estimated making use of 162 sufferers. MIPI score = 03535 * age + 0978 * (if ECOG PS 1) + 167 * log10…
T both interfaces. As an instance, Figure 2c shows a sharp BZY/MgO interface along with a standard defect (vertical antiphase boundary). The high crystalline top quality from the films makes…
Of sulfo-Cy3 conjugated hFasLECDs. Dot lines, Sulfo-Cy3-MT-hFasLECD; solid lines, Sulfo-Cy3-TM-hFasLECD. a UV-Vis spectra. The absorbance of Sulfo-Cy3-MT-hFasLECD was expressed as values with the experimental information plus 0.2. Insert, an look…
Hat have been differentially expressed only amongst CHS and CHR (TCONS_ 00000795, TCONS_00001205, TCONS_00033373), and three lncRNAs that were differentially expressed only involving CHS and ZZ (TCONS_00011964, TCONS_000 17539, TCONS_00017842)…
Id not change (Figure S5B). As anticipated, baseline ACE expression was also substantially larger in WT mice than in ACE 10/10 mice. Additional, when renal ACE expression remained unchanged inside…
Ion increases exposure of youngsters to STH infectious stages . Primary info on entry to WASH at colleges was collected throughout the baseline survey by interviewing the head instructor or…
Cells had been treated with car (DMSO) for 48 h and remained as mononucleated (CT) cells. Proper panel: cells began to fuse just after 48 h of FSK therapy, creating…
Nhibitor). This problem has received substantially interest specifically because it relates to the study of functional sympatholysis in each experimental animals and humans in vivo (Thomas et al. 1994; Buckwalter…
N Q-TWisT (95 CI) (nal-IRI+5-FU/LV minus 5-FU/LV)Q-TWiST in metastatic pancreatic cancer patients2.five two.0 1.five 1.0 0.five 0.three monthsnal-IRI+5-FU/LV betterother cancers, and is regarded clearly clinically crucial based on the published…
Hree years. Followup consisted of imaging, physical examination, endoscopic examinations, and laboratory tests. In case of suspicious illness progression or important toxicity, the follow-up intervals have been shortened. Acute and…
Tment, reasons for such changes integrated loss of efficacy (35.eight ), physician preference (27.eight ), security concerns (20.1 ), patient preference (17.9 ), or access to remedy (9.0 ) .…
Grand Island, NY) as described . The siRNAs are pools of at the very least three different siRNAAuthor Manuscript Author Manuscript Author Manuscript Author ManuscriptCell Signal. Author manuscript; offered in…
Y 0 to day four, from 1.6 9 105 cells/well to a imply of 1.5 9 106 cells/well on day 4 (Fig. 3A). This getting demonstrates active proliferation of those…
AreFrontiers in Microbiology | www.frontiersin.orgOctober 2015 | Volume 6 | ArticleChinnapaiyan and UnwallaHIV and illicit drug abuse suppresses mucociliary clearancecommon amongst cocaine users (Rubin and Neugarten, 1990; Leece et al.,…
Ntly that USP5-mediated deubiquitination is necessary as a way to promote translocation of FoxM1 into the nucleus, where it mediates interaction of -catenin with target gene promotors . We hence…
(vs. the manage group).2.five. Inhibition of Cyclooxygenase-2 (COX-2), NF-B and Matrix Metalloproteinase (MMP)-9 in HCC Cells 2.five. Inhibition of Cyclooxygenase-2 (COX-2), NF-B and Matrix Metalloproteinase (MMP)-9 in HCC Cells by…
Information not shown), or the EFS response to either strip weight or K + response (data not shown), the contraction of 6-OHDA bladder strips was not greater than in controlstrips,suggestingthattheefficacyofthereceptor…
Imulate PMNs and PBMCs in synergy to improve chemokine production, thereby attracting inflammatory cells towards the joints of patients with early RA.parallel PBMC cultures. All cytokines and chemokines were downregulated…
Tudies of twins, adoptees, along with other kinships. These study designs have many important makes use of, but they cannot discover distinct genomic regions or precise variants which can be…
Ivered for the analytical column by a Shimadzu LC-10ADVP pump equipped having a Shimadzu SCL-10ALVP Technique Controller. The solvent lines were mixed in an FCV-10ALVP mixer. For the degassing on…
Bstructive events.42 A current study performed at a sleep clinic evaluating 6841 sufferers for OSA revealed that independent predictors of AF incorporated apnea/hypopnea index (AHI) sirtuininhibitor5/hour and time with oxygen…
E ring decide the positions of thesegroups relative to one another. Hence, diverse binding modes are theoretically feasible depending around the ligand and target enzymes. Interestingly, the structural isomers of…
Y of IVIM to separate the impact on signal of molecular diffusion from that of capillary perfusion is readily apparent inside the kidney, as parameters reflecting perfusion (ADC, pseudodiffusion coefficient…
On in dopamine neurons. In this study we made use of a mouse model exactly where AMPK1 and AMPK2 had been successfully deleted in DAT expressing neurons. AMPK is composed…
Nd Optimization of Labeling An automated script was written and employed to recognize residues in LMCA1TM homology models (produced in MODELLER30 based on structures of SERCA) appropriate for the introduction…
N each H9 and FN2.1 cell viability working with a XTT/PMS important dye assay at 24 hours post Rapamycin (10 and 100 nM) therapy. Even so, inhibition of mTOR didn't…
Of viral NP protein expression was observed in cells pre-treated with ORFV infected cell medium (Fig. four). Noticeably, boost of inhibitory strength coincided together with the length of ORFV infection;…
Fferent context (MLS-M.CviPI: Nys-1 chorella virus GpCme methyltransferase31, MLS-hM. CviPII: humanised Nys-1 chorella virus CmeCD methyltransferase32), in C33A and HCT116 cells. Despite using previously published12 (and unpublished) primers (Table 1),…
Survival of individuals with mCRC which in some situations exceed two years . In last years, several evidences are accumulating on the function of immune system cells in controlling tumors…
Ers using Langmuir-Blodgett deposition and transferred under water towards the SFA, exactly where the preferred remedy was injected involving the surfaces for force measurements. The bilayers in the SFA experiments…
Al. 2014; Moylan et al. 2014). Importantly, in healthful livers, the SREBP2 signature was hugely enriched in cases with low LATS2 expression compared with those with highGENES DEVELOPMENTAylon et al.LATS2…
`information appointment'; `randomisation' ; `research nurse' ; 'PSA doubling time' ; or `active monitoring' (a term utilised within the Safeguard trial to describe one of three treatment arms; the term…
2 (12.96) 115.58 (12.80) 116.42 (13.26) 76.75 (11.59) 74.25 (10.63) 165.19 (six.96) 69.85 (19.15) Placebo (n = 12) 5 (41.67) 11 (92) 32.50 (9.80) 119.92 (13.83) 121.67 (16.17) 116.67 (11.85)…
S one remedy failure 46.1 (82/178), (2= 14.72; df =1; p 0.0001). There was also a considerable difference in remission rates on venlafaxine comparing those with at the least two…
Dicating additional serious symptoms. The VMS domain subscore inside the GCS ranges from 0 to 6, with greater scores indicating far more extreme symptoms.13 Yet another instrument, the Weekly Hot…
Ed making use of the BD FACSAriaII. Flow cytometric analysis and statistics were performed using FlowJo V.10.0.8.ATAC-seqK562 cells were stained and sorted for CD24 as described above. ATAC of five…
He current study, we designed a new combinatorial approach and showed that combination of a selective EGFR inhibitor plus a PARP inhibitor was effective in an A2780 (EGFR-overexpressing, BRCA1/2 wildtype)…
And Youngster Wellness Hospital of Nanjing Healthcare University, 123 Tianfeixiang, Mochou Road, Nanjing, Jiangsu 210004, P.R. China E-mail: [email protected] equallyKey words: breast cancer, benign breast illness, hypermethylation,molecular epidemiology, diagnosisWU et…
R both maize varieties though no time-dependent reduction on the mycotoxins was recorded for the white maize (Figure six). For the yellow maize, percentage reduction of CIT and FB3 drastically…
The G2/M cells within the BrdU-positive cells at 0 and 8 hour chase periods. (C) The experimental protocol for the immunofluorescent visualization of subnuclear H2AX concentrate formation in wild-type and…
Ults in excellent losses in agricultural income and includes a considerable damaging economic influence. Numerous procedures are created for pre- and post-harvest aflatoxin management . Classic approaches, including fungicides, have…
Preeclampsia (Table two; Figure 1). Hispanic ethnicity (RR, 1.07; 95 CI, 0.76.50), African American race (RR, 1.42; 95 CI, 0.98.06), BMI 30 (RR, 1.34; 95 CI, 0.88.03), smoking (RR, 0.91;…
L-time PCR (qRT-PCR) using the SYBR Green PCR Kit (TIANGEN, China) and also the assay was performed on an ABI PRISM 7500 Sequence Detector. Expression data have been uniformly normalized…
6 wks immediately after RYGB. (b) Fasting insulin in ob/ob mice in the 6-wk-old group. (c) Insulin tolerance test (ITT) in WT mice. Insulin was administrated at 0.7 U kg-1…
Evaluated applying bioinformatics and available genome databases . Nevertheless, identifying targets essential to general fitness from the target species calls for experimental validation. Genetic methods possess the prospective to validate…
L.for this study. We thus assessed only 4 animals. Unfortunately, among the list of animals created extreme macular hemorrhages and couldn't be assessed working with all of our metrics. Nevertheless,…
The paired suprachiasmatic nuclei (SCNs) would be the principal circadian clock of . The paired suprachiasmatic nuclei (SCNs) will be the principal circadian clock of mammals. Each and every consists…
Raison et al., 2013; S ann et al., 2013; Uher et al., 2014). SinceRaison et al., 2013; S ann et al., 2013; Uher et al., 2014). Since S100B also has…
Tion (LOD) and limit of quantitation (LOQ), robustness, and ruggedness. ValidationTion (LOD) and limit of quantitation (LOQ), robustness, and ruggedness. Validation in the proposed system was carried out inInternational Scholarly…
Determined making use of a fluorescence spectrophotometer with an PTPRC/CD45RA Protein medchemexpress emission wavelength of 488 nmDetermined applying a fluorescence spectrophotometer with an emission wavelength of 488 nm and excitation…
Mrlu/. We outline the workflow from the system and final results fromMrlu/. We outline the workflow of your method and outcomes from the method of implementation. Upon opening the browser,…
Urgical and surgical periodontal therapy and sufferers who had not appliedUrgical and surgical periodontal therapy and patients who had not used any antibiotics, anti-inflammatory drugs, and any other over the…
Rom Millipore (catalog no. 420099), and cycloheximide was from Sigma (C7698).AuthorRom Millipore (catalog no. 420099), and cycloheximide was from Sigma (C7698).Author Contributions--J. E. H. as well as a. S. B.…
Out of 71. These RT values were applied as an initial worthOut of 71. These RT values have been utilized as an initial value to get the EIC-based intensities. For…
Cites generated from PC14PE6 cells (a present from Isaiah J.Cites generated from PC14PE6 cells (a gift from Isaiah J. Fidler; MD Anderson Cancer Center, Houston, TX, USA) in nude mice…
OI ten.2450/2017.RANTES/CCL5 Protein Species 0196-SIMTI Servizi SrlTIBackground. Direct oral anticoagulants (DOAC) happen to be shownOI 10.2450/2017.0196-SIMTI Servizi SrlTIBackground. Direct oral anticoagulants (DOAC) have been shown to be non-inferior to classic…
D with pri-miR-221/222 (pri-miR-221: r = -0.491, P 0.0001 and pri-miR-222: r = -D with pri-miR-221/222 (pri-miR-221: r = -0.491, P 0.0001 and pri-miR-222: r = -0.497, P 0.0001 Student's…
(Qiagen, Manchester, UK), according to the manufacturer's instructions. The mERa(Qiagen, Manchester, UK), according to the manufacturer's directions. The mERa failed to transactivate the (ERE)3pGL3promoter in Adrenomedullin/ADM Protein MedChemExpress response to…
Acts, respectively. Okadaic acid (Calbiochem) was applied at 500 nM or 2 mMActs, respectively. Okadaic acid (Calbiochem) was applied at 500 nM or 2 mM as indicated, MG132 (Calbiochem) at…
Ntrations in each VLDL/ LDL and HDL fractions (Fig. 1G). TheseNtrations in both VLDL/ LDL and HDL fractions (Fig. 1G). These studies showed that intestine-specific MTP ablation is related with…
5000 mg/kg when for the chronic oral consumption the dose is5000 mg/kg while for the chronic oral consumption the dose is as much as 2500 mg/kg, all of which did…
Ported by a grant from the National Institute of Psychobiology inPorted by a grant from the National Institute of Psychobiology in Israel and Recanati fund. This short article contains supplemental…
Abricated A 15 sirtuininhibitor15 mm Si (one hundred) wafer is applied as the substrate.Abricated A 15 sirtuininhibitor15 mm Si (one hundred) wafer is utilized because the substrate. Before the biosensing…
The Fiehn and NIST libraries, about 32 and 35 with the analytes have beenThe Fiehn and NIST libraries, about 32 and 35 with the analytes had been identified working with…
Illness (CKD). Limitations of this study include things like the fairly little sampleIllness (CKD). Limitations of this study consist of the comparatively modest sample of individuals who have been tested…
Cid interactions,102 for use in rapidly predicting preferred genomic binding sitesCid interactions,102 for use in quickly predicting preferred genomic binding web sites for proteins. Other individuals have sought to develop…
For IL-22 functions . Also, many reports indicated that excessive IL-For IL-22 functions . Also, several reports indicated that excessive IL-22 can lead to tumor development, inhibition of apoptosis, and…
Body mass index (BMI)-for-age (also referred to as thinness).64 Final results forPhysique mass index (BMI)-for-age (also known as thinness).64 Outcomes for all anthropometric indices will likely be computed as Z-scores…
Oved to adversely impacts immune function. Additionally, adjustments in day-to-day rhythmsOved to adversely affects immune function. Additionally, modifications in every day rhythms of heart rate, heart rate variability and blood…
Including epilepsy, numerous sclerosis and bipolar disorder (Jourquin et al. 2005; RybakowskiIncluding epilepsy, various sclerosis and bipolar disorder (Jourquin et al. 2005; Rybakowski et al. 2009; Reinhard et al. 2015).…
O-hybrid screening. pcDNA3.1-Myc-hTM4SF1 was NFKB1 Protein Species obtained by the respective cloningO-hybrid screening. pcDNA3.1-Myc-hTM4SF1 was obtained by the respective cloning of hTM4SF1 genes into the mammalian expression vector pcDNA3.1-Myc (Invitrogen,…
Huge case-control sample: RNAseq supplies insights into disease mechanisms. J InvestSignificant case-control sample: RNAseq gives insights into illness mechanisms. J Invest Complement C3/C3a Protein Species Dermatol 134(7):1828sirtuininhibitor838. 23. van der…
78;submit your manuscript | www.dovepressImmunofluorescence staining and imagingFor intracellular staining, BMDMs78;submit your manuscript | www.dovepressImmunofluorescence staining and imagingFor intracellular staining, BMDMs and BMDCs have been fixed with 4 (w/v) paraformaldehyde…
Function26. We thus propose that Scube2 bridges the gap in between HSPG-associatedFunction26. We thus propose that Scube2 bridges the gap among HSPG-associated Shh substrates and their soluble or cell-surface-associated sheddases…
G beads have been used in anti-ER or anti--tubulin antibodies. An anti-rabbitG beads have been employed in anti-ER or anti--tubulin antibodies. An anti-rabbit IgG beads were utilized in the absence…
Ddition to A aggregation, phosphorylated Tau protein also accumulated, suggesting thatDdition to A aggregation, phosphorylated Tau protein also accumulated, suggesting that both of those processes are accelerated by 3D culture…
Ively . Thus, E157Q polymorphism doesn't appear to effect phenotypicIvely . Therefore, E157Q polymorphism will not appear to influence phenotypic susceptibility to RAL or DTG, in contrast a prospective low-level…
Sterone concentrations. (A) Schematic depicting the experimental protocol. Ahead of the hypnoticSterone concentrations. (A) Schematic depicting the experimental protocol. Before the hypnotic drug infusion, the first blood sample was drawn…
Inoembryonic antigen and fetoprotein and their associations with cancer threat. Gut.Inoembryonic antigen and fetoprotein and their associations with cancer threat. Gut. 2014;63(1):143sirtuininhibitor51. 22. Moore T, Kupchik H, Marcon N, Zamcheck…
Fold (n = 127) (n = 432) Total P ValueTable 1 The HMGB1/HMG-1 Protein web analysis of CYFRA21-Fold (n = 127) (n = 432) Total P ValueTable 1 The evaluation…
T is going to be productive. Constant with that prediction, we showed thatT might be helpful. Constant with that prediction, we showed that knockouts of individual ACCs had only modest…
S had been injected with DSP4 through preadolescence, adolescence or adulthood. BrainsS had been injected with DSP4 for the duration of preadolescence, adolescence or adulthood. Brains have been harvested later…
Days, MIF Protein Accession followed by five mg each and every 12 h for 6 months); or standard anticoagulantDays, followed by five mg every single 12 h for 6 months);…
Rative unfolding with the -domain and C-helix on the I56TRative unfolding on the -domain and C-helix of your I56T and D67H variants (Figure four). Furthermore, MS information in fact show…
E to agents tested, employing DHT as a marker of redoxE to agents tested, employing DHT as a marker of redox status and healing, might be cautiously extrapolated for the…
Vious studies indicated that GLU was found to substantially raise theVious studies indicated that GLU was located to drastically enhance the activity of caspase-9 and -3 in colon cancer cell…
VepressClinical, Cosmetic and Investigational Dermatology 2018:DovepressDovepressDupilumab assessment with the literatureNotes: aSubjectsVepressClinical, Cosmetic and Investigational Dermatology 2018:DovepressDovepressDupilumab evaluation of the literatureNotes: aSubjects have been adults older than 18 years with moderate-to-severe…
Nhibit IL-8/CXCL8 Protein Source insulin signaling (21,27), we subsequent examined whether or not TSP-1 affects the serineNhibit insulin signaling (21,27), we subsequent examined whether or not TSP-1 affects the serine…
Ility and consistency. All round, these criteria assist establish high top quality, sustainableIlity and consistency. General, these criteria support establish high high-quality, sustainable lines for producing reagents indefinitely.Advantages with the…
Were up/down-regulated across five lines, presenting a venue to knowHad been up/down-regulated across 5 lines, presenting a venue to know the individual profile of drug pharmacology utilizing systems biology. The…
Models. Virus-induced gene silencing of Hsp90, BBI, and REP14 genes indicatedModels. Virus-induced gene silencing of Hsp90, BBI, and REP14 genes indicated that virus-silenced plants subjected to cold strain had much…
Ssion (Fig 6C, proper panel). These findings clearly indicate that HHTSsion (Fig 6C, appropriate panel). These findings clearly indicate that HHT and HT inhibit 2'3'-cGAMP-induced expression of ISGs.PLOS A single…
1896604 and rs843720) and lung cancer within the Chinese Han population. Our1896604 and rs843720) and lung cancer within the Chinese Han population. Our findings recommend ACYP2 could be a valuable…
He follow up information of this cohort HGF Protein Molecular Weight patients within this study.He follow up information of this cohort sufferers in this investigation. These comply with up data…
OI 10.2450/2017.0196-SIMTI Servizi SrlTIBackground. Direct oral anticoagulants (DOAC) have already been shownOI 10.2450/2017.0196-SIMTI Servizi SrlTIBackground. Direct oral anticoagulants (DOAC) have been shown to be non-inferior to conventional vitamin K antagonists…
Tion 1:1000 (1 h, area temp.). The rinsings of probes in buffered NaClTion 1:1000 (1 h, room temp.). The rinsings of probes in buffered NaCl solution (PBS, 0.1 mol, pH…
R orbitals (FMO) of all 15 reactant pairs (for information see SupportingR orbitals (FMO) of all 15 reactant pairs (for information see Supporting Info). The relevant FMOs and energies are…
) represents the free power distinction among the wild-type and double mutant) represents the free energy distinction among the wild-type and double mutant; G(x) and G(y) represent the Fas Ligand…
Nding around the IGF-I/IGF-1 Protein Accession levels of CEA, CYFRA21-1 and NSE, theNding around the levels of CEA, CYFRA21-1 and NSE, the study subjects were divided into 3 groups (negative,…
OI ten.2450/2017.0196-SIMTI Servizi SrlTIBackground. Direct oral anticoagulants (DOAC) have been shownOI ten.2450/2017.0196-SIMTI Servizi SrlTIBackground. Direct oral anticoagulants (DOAC) have already been shown to become non-inferior to standard vitamin K antagonists…
O et al. Malaria Journal 2014, 13:152 malariajournal/content/13/1/Page 3 ofFigure 1 Prevalence of Pfdhfr and Pfdhps mutations in Tanzania. X-axis represents the six regions sampled and y-axis presents percentage prevalence…
Riacylglycerol (TAG) molecule self-assembles as a result of van der Waals interactions and excludes water. Based alone on these physicochemical properties, fat would be able to type a separate organelle…
Anchored proteins play critical roles in distinctive processes connected to host-parasiteAnchored proteins play significant roles in diverse processes related to host-parasite interaction. Also, it has been recommended that, because of…
Nt, as it occurs in drugresistant cell lines , . A number of reports proposeNt, since it occurs in drugresistant cell lines , . Quite a few reports propose a…
Ytic activity at distinctive temperatures (27 to 67 ). Then thermal denaturation was assessed through tryptophan fluorescence measurements (Table two). TEM-1 and M182T presented related catalytic activities at 37 (Table…
D Schuell) by electrotransfer for 90 min RNA was mixed with primers and dNTPs, denatured by heat- at 400 mA. The membrane was washed for 1 h in PBS/milk/ ing…
Aive cells possess a compact subpopulation of cells that happen to be mesenchymal, erlotinib resistant, and related to H1650-M3 cells (Yao et al., 2010), indicating that H1650-M3 cells were potentially…
By utilizing the Pearson solution moment correlation coefficient test. Stepwise variousBy using the Pearson product moment correlation coefficient test. Stepwise a number of linear regression analysis was performed in an…
Previously described . Briefly, mouse embryos ware harvested at E13.five for LCM.Previously described . Briefly, mouse embryos ware harvested at E13.five for LCM. Embryo heads have been immediately embedded in…
E gave subcutaneous injections (0.1 ml) of leptin dissolved in saline (two ng per g body mass of toad) or saline as soon as each day for six sequential days.…
Tive Neuroscience and Endocrinology, School of Clinical Sciences, University of Bristol, Dorothy Hodgkin Creating, Bristol BS1 3NY, UK 3 St Michael's Hospital, Southwell Street, Bristol BS2 8EG, UK Full list…
As lowered more than time in each 2D and 3D culture, but that this reduction was a lot greater in 2D culture. To ascertain no matter if the lowered intensity…
D as an extra layer.17,34 Implementation. CoLIde has been implemented utilizingD as an extra layer.17,34 Implementation. CoLIde continues to be implemented applying Java and is incorporated as a part of…
Cyl sulphate (SDS, Scientific Supplies, Auckland, NZ), sterile 0.9 saline remedy. OtherCyl sulphate (SDS, Scientific Supplies, Auckland, NZ), sterile 0.9 saline solution. Other chemical substances had been of analytical grade…
Herapy was equivalent among case and manage subjects, case subjects received much more distinctive antibiotics. As a result, therapy of XDR-GNB probably outcomes in additional antibiotic exposures and additional antibiotic…
Cell wall and plasmodesmata-associated genesThe plasmamembrane Artemin Protein site component was hugely represented in T200 and TME3, and there was also a noticeable expression of cell wall-related transcripts (Figure three).…
Actions. Binding reactions are also instructive examples for the versatile readout of processes involving hyperpolarized molecular probes beyond PENK Protein supplier chemical shift adjustments (Figure 3B). Binding to a macromolecular…
Dried at 60 in vacuum. X-ray diffraction (XRD) analysis was performed withDried at 60 in vacuum. X-ray diffraction (XRD) evaluation was performed using a Rigaku DMAX-2500 VPV spectrometer by utilizing…
Follicles (Figure S3). The additional severe arrest in Crect; RR; WlsFollicles (Figure S3). The much more severe arrest in Crect; RR; Wls flfl mutants (Figure two) recommended ectoderm Wls seems…
T that increased i and purinergic signaling in response to FSS-dependent ciliary bending triggers a fast and reversible raise in apical endocytosis that contributes for the effective retrieval of filtered…
Mine two-dimensional spatial patterns (e.g., horizontal layering, clustering, and dispersion) over fairly substantial regions of the uppermost surface of ST6GAL1 Protein manufacturer Type-1 and Type-2 mats (Figure 2A1,B1). Greater magnifications…
Onal technical limitations. For these causes, reconstitution of ion channels into planar lipid bilayers (also known as black lipid membranes or BLM) is the most broadly made use of process…
Es is vital for the host immuneJournal of Immunology ResearchTable 1: OutcomeEs is crucial for the host immuneJournal of Immunology ResearchTable 1: Outcome data in the 20 TMEM173, Human (Sumo-His)…
Ized Lumican/LUM Protein Formulation Triton X-100, SDS or trypsin samples showed no cells, andIzed Triton X-100, SDS or trypsin samples showed no cells, plus the mesh of collagen fibers was…
Array of KCNJ3 and KCNJ6 SNPs on oral analgesic medication orders within a substantial Complement C3/C3a Protein Species clinical postsurgical key sample, with replication of the resulting pain-relevant SNPs on…
Ment of all at the moment recognized Cip1 homologs and also the residues coordinating the calcium ion are marked in yellow. The calcium ion is situated at a critical position…
Of PKCa observed in erlotinib-resistant cells. Ultimately, we sought to establish an association in between PKCa upregulation and TGF-b signaling inside the induction of your mesenchymal phenotype. H1650 cells have…
I-inflammatory drugs, and antidepressants are most generally involved in overdoses amongI-inflammatory drugs, and antidepressants are most frequently involved in overdoses amongst young children.7 EphB2 Protein manufacturer public awareness in the…
Ells (MHCC-97H), we established stable MHCC-97H cell lines withElls (MHCC-97H), we established steady MHCC-97H cell lines with down-regulation of CTSL by shRNA sequences against CTSL (MHCC-97H-CTSL-shRNA). As shown in Figure…
S by centrifuging at 10000 rpm for 20 min in 4uC. The protein concentration was analyzed by Bradford protein assay (Bio-Rad, USA). The entire protein was separated with ten SDS-PAGE…
Thane (13 and 14). Initially, we thought that condensation utilizing ethenes 11 or 12 could suffice, but that proved obstinate and unworkable; whereas, the lowered 13 and 14 reacted satisfactorily.…
Dministered via an anesthetic machine. A transabdominal ALOKA SSD-1000 ultrasound having a 5-MHz probe was employed to find fetuses. A 22-gauge spinal needle was inserted by way of the skin…
Ation involves the attack of totally free radicals (formation by oxygen) toAtion requires the attack of free radicals (formation by oxygen) to adjacent positions of double bonds , and these…
T immunofluorescence with DAPI stained nuclei (A ). Boxed areas correspond toT immunofluorescence with DAPI stained nuclei (A ). Boxed areas correspond to higher magnification Insulin-like 3/INSL3 Protein Biological Activity…
Ng recombinant vaccinia: implications for vaccine development. J Exp Med. 1992; 176:169?76. 10. Burrows SR, Sculley TB, Misko IS, Schmidt C, Moss DJ. An Epstein-Barr virus- certain cytotoxic T cell…
Indicated HIN proteins at many concentrations. (b) Graphical representations of the p202 HINa domain in complex with a 20 bp dsDNA in two views associated by a 90 rotation around…
Od response to intravenous Ig injection (IVIg) and plasma exchange, suggesting that these antibodies may perhaps take part in the demyelination procedure. The passive transfer of anti-NF155 antibodies in rats…
Insic tryptophan (plasma FXIa) and dansyl fluorescence (DEGR-FXIa). Both UFH andInsic tryptophan (plasma FXIa) and dansyl fluorescence (DEGR-FXIa). Both UFH and H8 showed a saturating lower in tryptophan fluorescence, albeit…
Sulfasalazine (3 g everyday) commenced. The only other history of note wasSulfasalazine (three g every day) commenced. The only other history of note was an episodeof obstructive cholestasis. He was…
Se in hippocampal NAE levels that was observed right after a single dose of IMI. Lastly, the adaptive alterations within the frontal cortex and cerebellum that followed ESC remedy had…
And HCC, but decreases in individuals with chronic hepatitis and liver cirrhosis (39). Since AGP is synthesized and secreted by hepatocytes, damage and injury to liver parenchyma can influence the…
Biological fluids offers a direct assessment of GAG storage. Having said that, quantitation of total GAG for molecular diagnosis is limited without further analysis on the sort of GAG that…
Result on the oxidationreduction of bound mediators inside the biofilm thatOutcome with the oxidationreduction of bound mediators in the biofilm that will be modeled as a pseudocapacitance, C1, as shown…
Fmotorblock(min) Firstanalgesicrequest(min) Shivering(n) Nausea(n) Vomiting(n) PruritusFmotorblock(min) Firstanalgesicrequest(min) Shivering(n) Nausea(n) Vomiting(n) Pruritus(n) Group C (n=21) Group Mg (n=20) pRESULTS One patient in Group C was excluded due to inaccurate magnesium measurements…
Effects of cigarette smoke and neutrophil elastase. Am J Respir Cell Mol Biol 2004;30:500?. Lee WK, Ramanathan M Jr, Spannhake EW, et al. The cigarette smoke element acrolein inhibits expression…
Ribed above. ChIP assays. ChIP assays were performed basically as previously described (12). Cells have been cross-linked by incubation with 1 fresh paraformaldehyde at area temperature for 10 min, quenched…
Y demonstrated that the enhanced expression of CD11b and CD14 was induced by the remedy of IL-32, but it was markedly blocked by the treatment of BS (Fig. 4D).Effects of…
Ial support, and Manasa Kanneganti for her IgG1, Human (D239E, L241E, HEK293) technical assistances in executingIal help, and Manasa Kanneganti for her technical assistances in executing some experiments on this…
Y2.0), which permits unrestricted use, distribution, and reproduction in any mediumY2.0), which permits unrestricted use, distribution, and reproduction in any medium, offered the original work is properly cited.Kawaguchi-Niida et al.…
Red) and expression of your transgenic proteins did not considerably rescue the susceptibility. The total quantity (N) of adult flies tested is shown. (B) Survival curves of females homozygous for…
The IB-4 antibody option was devoid of Triton-X-100 (1:1000 dilution of anti-IB-4 lectin (Invitrogen, Burlington, ON, Canada) in five horse serum + PBS) overnight at four . The sections had…
Oth muscle InsP3R1 in 1988 (Ehrlich and Watras 1988), and native cerebellar InsP3R1 and RyanR in 1991 (CDK5 Inhibitor site Bezprozvanny et al. 1991). The key procedures employed in these…
I 3H-oleic acid in 3.5 FA absolutely free BSA was infused by means of portalI 3H-oleic acid in three.5 FA absolutely free BSA was infused by means of portal vein…
Shed in the absence of that substance (a blank worth) withinShed in the absence of that substance (a blank worth) inside a stated self-assurance limit. The limit of quantification is…
Ineate the molecular mechanism by which F311 enables STEP to recognise phospho-ERK, we inspected the activity of F311A toward the alanine-scanning library on the ERK-pY204 peptide (Fig 7A and C).…
Is controlled by the MarR-like transcriptional regulator Rv0678. Results: Rv0678 types a dimeric two-domain molecule with the architecture similar to members with the MarR loved ones of transcriptional regulators. Conclusion:…
S an equal probability of being represented. We enjoy this productive dialogue and an outside point of view revealing a significant factor of normalization that was not readily apparent to…
Sial layers of the dorsal fillets. A) Hard muscle tissues show aSial layers with the dorsal fillets. A) Tough muscles show a fine line of Col I between two adjacent…
T 24 h and declined immediately after that. For 3 FBS, the highest levelsT 24 h and declined after that. For 3 FBS, the highest levels of NO had been…
Se, SAP1, two and 3 from Candida albicans and pepsin belong towards the group of aspartic proteases and share a popular catalytic mechanism. Despite their distinctive origin from a vertebrate,…
Omise. SANS data is often incorporated into solution structure refinement by utilizing NOEs toInt. J. Mol. Sci. 2013,solve the short-range interactions along with the SANS data for the shape. This…
Y increased LV mass compared with sedentary rats that only received car (Figure 1B/1C). As indicated in Figure 1, there was a clear effect of exercising on LV enlargement; therefore,…
Cterized by NMR spectroscopy. The proton spectrum displayed a single setCterized by NMR spectroscopy. The proton spectrum displayed a single set of resonances for the tripyrrolic ligand, consistent using a…
Lled C. neoformans (Figure 3A 3B). The crystal violet uptake byLled C. neoformans (Figure 3A 3B). The crystal violet uptake by J774.16 cells was not affected by 213Bi-labeled 18B7 (Figure…
Spirosis occur inside the tropics and it can be challenging to distinguish malaria from these illnesses on clinical grounds alone. Haematological alterations connected with malarial infection, including haemoglobin, packed cell…
Idson BR, Rolles K, Burroughs AK, Hodgson HJ, Foster CS, Cox IJ. In vivo and in vitro hepatic 31P magnetic resonance spectroscopy and electron microscopy of the cirrhotic liver. Liver…
Line MRC-5 were infected with Ad p-E1A(24) and Ad p-E1A(24)TSLC1 at an MOI of 10, and cell proliferation was measured working with the MTT assay. As shown in Figure 3,…
And PCR analyses indicated that the neomycin and hygromycin resistance genesAnd PCR analyses indicated that the neomycin and hygromycin resistance genes had been inserted into each TcGPI8 alleles, PCR amplifications…
Se sequences as well as the recognized structure on the GPI anchor inSe sequences and also the known structure from the GPI anchor within this parasite (Figure 1A) , we…
Ation questionnaire of asthma decreases the usefulness of this approach forAtion questionnaire of asthma decreases the usefulness of this process for assessing the prevalence of asthma. The prevalence following the…
Ed the inhibitory effects of RC-derived diterpenoid C on H. pylori-induced GES-1 cell inflammation. In this study, within the absence of stimulus, GES-1 cells secrete a tille cytokine. Soon after…
Standing hyperlipidemia. Am. J. Clin. Nutr. 2005, 81, 583?89. 26. Eschen, O.; Christensen, J.H.; de Caterina, R.; Schmidt, E.B. Soluble adhesion molecules in healthier subjects: A dose-response study employing n-3…
MT2 medchemexpress Thylation, increases reactivity by two orders of magnitude. In contrast toThylation, increases reactivity by two orders of magnitude. In contrast to existing orthodoxy and mechanistic explanations, we propose…
Imilar numbers of cells in each and every domain have been analyzed amongst 4Imilar numbers of cells in each domain had been analyzed in between 4 controls and mutants. Statistical…
Handle groups show P45 RP (A), P59 RP (B), and PHandle groups show P45 RP (A), P59 RP (B), and P87 RP (C) retinas 1 hour, two weeks, and six…
Of either bglJ (T1030) or leuO (T1146), leading to a constitutive synthesis of BglJ (bglJC ) or LeuO (leuOC ), respectively.28 To quantify the transcription initiation in the Pcas promoter,…
S an equal probability of becoming represented. We value this productive dialogue and an outdoors viewpoint revealing an essential aspect of normalization that was not readily apparent to us when…
On from the pattern corresponding to every single sRNA is managed byOn of the pattern corresponding to every single sRNA is managed ALK2 Inhibitor list through the user-defined parameter ,…
And 50 ngmL for 48 h, along with the proliferation ErbB2/HER2 web activity determined by aAnd 50 ngmL for 48 h, plus the proliferation activity determined by a CCK8 kit…
Say, which were attributed to extrachromosomal Tcircles generated by improper resolution of T-loops (15). Nonetheless, such an increase was not observed in mRtel1-deficient mouse embryonic stem cells by 2D gel…
Se in IgG immune complex-induced secretion of theses cytokines and chemokines from neutrophils (TNF- and KC at all time points, Fig. 7A and C; IL-6 and MIP-1 at 4? h…
Ssion and the FRET signal, respectively. The certain FRET signal was calculated making use of the following equation: F one hundred (Rpos Rneg)/(Rneg), where Rpos could be the fluorescence ratio…
And inositol acylation , , . It truly is noteworthy that, amongst all tested genesAnd inositol acylation , , . It really is noteworthy that, amongst all tested genes, we…
Arly for the genomic alterations we observed in the T. cruziArly for the genomic alterations we observed inside the T. cruzi double resistant TcGPI8 mutants, an attempt to build a…
Ts and 76/77 (98.7 ) of vaccinees who weren't subsequently infected by wildtype EBV developed gp350 antibodies. The efficacy analysis consisted of following the subjects for as much as 19…
Gyrus from both groups have been cultured in vitro. Hundred early L4 larvae or five females had been incubated inside a 24-well plate containing 500 RPMI 1640 supplemented with 100U…
Ntrols.was observed in other colon cancer cell lines treated with ITCs (Table S1). Fluorescence-activated cell sorting revealed no considerable DOT1L Inhibitor MedChemExpress influence of AITC on cell cycle kinetics, compared…
Es is essential for the host immuneJournal of Immunology ResearchTable 1: OutcomeEs is important for the host immuneJournal of Immunology ResearchTable 1: Outcome data within the 20 sufferers in the…
Imilar numbers of cells in every domain had been analyzed among fourImilar numbers of cells in every single domain were analyzed involving 4 controls and mutants. Statistical significance for all…
Ted ALT level elevations in wholesome volunteers normally only after 7 to ten days of acetaminophen exposure, it ought to not be surprising that we didn't witness this phenomenon in…
Pe in the presence of hydroxyurea (HU), which depletes nucleotide pools and disrupts DNA replication (Figure 1D). A `cut' phenotype can arise from a DNA integrity checkpoint defect in which…
Bury, CT) beneath room temperature for 30 min, followed by centrifugation at 2,080 g for 30 min. The extraction process was repeated 3 occasions and the supernatants had been combined…
Anti-FSHR antibody (150 pgml) (17). Intracellular cAMP levels were measured using a commerciallyAnti-FSHR antibody (150 pgml) (17). Intracellular cAMP levels had been measured using a commercially offered kit . FSH…
T immunofluorescence with DAPI stained nuclei (A ). Boxed places correspond toT immunofluorescence with DAPI stained nuclei (A ). Boxed regions correspond to high magnification panels (A9 9). (EPS)AcknowledgmentsWe thank…
S, we created a brand new strategy that was based around the C-spine residues. Ala70 in PKA is usually a C-spine residue that sits on leading on the adenine ring…
Inflammatory style, can be the best method to safeguard sensory neurons from Vpr and HIV.NIH-PA Author Manuscript NIH-PA Author Manuscript NIH-PA Author ManuscriptSupplementary MaterialRefer to Net version on PubMed Central…
Ers due to the fact the existing markers are insensitive. Hence, the identification of circulating miRNA as biomarkers for human liver diseases is of clinical and scientific interest.?2012 The Canadian…
Nditions are reported in Table S2.In vivo tumour growth analysesFemaleNditions are reported in Table S2.In vivo tumour development analysesFemale CB.17 SCIDSCID mice aged four weeks (Harlan; Correzzana, Milan, Italy) were…
Sulfasalazine (three g every day) commenced. The only other history of note wasSulfasalazine (three g everyday) commenced. The only other history of note was an episodeof obstructive cholestasis. He was…
Ependent15250?5255 | PNAS | October 21, 2014 | vol. 111 | no.Areduction in skeletal muscle specific force (ten). Acute induction of RyR1-mediated SR Ca2+ leak with rapamycin, which competes the…
Ble, which makes the separation from the solution from excess hydroxylamine (also water soluble) tough. Our aim was to create a technique to lessen the reaction time and retain high…
Cells had been re-stimulated with PMA and Ionomycin for five hours and BFA for four hours, IFN-, IL-4 and IL-17 expression was measured by flow cytometry.Author Manuscript Author Manuscript Author…
Thylation, increases reactivity by two orders of magnitude. In contrast toThylation, increases reactivity by two orders of magnitude. In contrast to current orthodoxy and mechanistic explanations, we P2Y2 Receptor manufacturer…
Phoinositide dependent protein kinase-1 (PDK1) brings v-akt murine thymoma viral oncogenePhoinositide dependent protein kinase-1 (PDK1) brings v-akt murine thymoma viral oncogene homolog 1 (AKT) for the plasma membrane, exactly where…
R6.2 translocation and pAMPK phosphorylation have been induced when the glucose concentration in the media was lowered to 8 mM, that is equivalent to the blood glucose amount of WT…
Nmouth movements and lateral tongue protrusions) and bitter eliciting a lot more aversive behaviors (mostly gapes and chin rubs). Also as previously reported (Yamamoto et al. 1994; Harrer and Travers…
Say, cells had been plated on 96-well tissue culture plates at 5 9 104 / mL within a total volume of 100 lL together with the indicated agents and assayed…
Buffer before stopped-flow syringes had been SSTR2 Gene ID loaded with anaerobic substrate and enzymeBuffer just before stopped-flow syringes had been loaded with anaerobic substrate and enzyme solutions. Multiwavelength data…
Ansformed with plasmids containing the corresponding yeast genes (ScDPM1 or ScGPIAnsformed with plasmids containing the corresponding yeast genes (ScDPM1 or ScGPI12) or using the T. cruzi genes (TcDPM1 or TcGPI12),…
Ocardial infarction, stroke, and other cardiac and cerebrovascular outcomes. Study participants had been followed for 1, five, or 7 years. The Women's Well being Initiative trial performed 12 analyses of…
Ig. 1(B)]. Third, the GABA concentration recent response curve had an EC50 of 36 six 2 lM and Hill coefficient of one.seven 6 0.one , comparable to reported values for…
Pe in the presence of hydroxyurea (HU), which depletes nucleotide pools and disrupts DNA replication (Figure 1D). A `cut' phenotype can arise from a DNA integrity checkpoint defect in which…
Rs (Lane 4).Production of rabbit anti-mouse IgG2b As a way toRs (Lane four).Production of rabbit anti-mouse IgG2b So as to check the production of antibodies in the rabbit and evaluate…
Previously GLUT1 manufacturer described . Briefly, mouse embryos ware harvested at E13.5 for LCM.Previously described . Briefly, mouse embryos ware harvested at E13.five for LCM. Embryo heads have been promptly…
Olume and TP, AP, and Ca2+; whereas volume exhibited a good correlation with GLU. Despite the fact that sperm concentration was negatively correlated withResults Semen CharacteristicsAlthough all bulls produced spermic…
Ase is definitely an crucial function of your ribbon. Therefore, it can be tempting to speculate that Piccolino plays a part in these processes. Together with the identification of Piccolino,…
Uitment to ubiquitinated cytosolic Salmonella, thereby enhancing LCScientificaNonCCR3 Antagonist MedChemExpress Selective Bacteria PAMP TLRs PAMPXenophagyLC3-associated phagocytosisPhagolysosomeLC3 Selective SLR Ub LC3 XenophagyLysosomeFigure 4: The autophagic response against intracellular pathogens (xenophagy) is…
Roups was not definitely random; as outlined by our results, individuals whoRoups was not actually random; in line with our outcomes, individuals who had been exposed to a larger volume…
E versatility to explore the conformational influence of unique regulators. TheE versatility to discover the conformational effect of distinctive regulators. The conformationspecific binding of A32 Ab shows that mechanical force…
D as a negative manage. Except exactly where noted, feeding RNAi was performed in L1 larvae, which have been synchronized as follows: gravid adults grown at 20?have been treated using…
Matched chowfed WT mice (Fig. 6). Livers from these strains also showMatched chowfed WT mice (Fig. 6). Livers from these strains also show elevated expression of RA-responsive gene expression. The…
Ml employing YM-10 filter. Ion-exchange chromatography was performed using FPLC programMl utilizing YM-10 filter. Ion-exchange chromatography was performed applying FPLC technique on a robust cationic exchanger Mono-S pre-packed column (0.five…
Hanol, 2 mM L-glutamine, 100 U of penicillin/ml and 0.1 mg/ml streptomycin. Subsequently, 2 ?106 cells were stimulated with 25 ng/ml PMA and 1 g/ml ionomycin (SigmaAldrich) in complete RPMI…
Alysis from the tissue biopsy showed prominent astrocytosis thought to becomeAlysis in the tissue biopsy showed prominent astrocytosis believed to be connected to an underlying or adjacent low-grade neoplasm. Just…
And equivalent amounts (105 g) of total cellular proteins were separated byAnd equivalent amounts (105 g) of total cellular proteins were separated by electrophoresis on a 12 SDS - IL-6…
Subtracted in the image containing both cyanobacteria along with other bacteria using a change-detection protocol. Following this classification, places inside pictures that were occupied by each and every feature of…
E neutral fat by adding a fatty acid to the axenic IKK-β Inhibitor supplier medium (Fig. 1). It is fascinating that added fatty acid is incorporated very first into TAG…
Ile includes a lowered pKa value, as a result bringing the maximum activityIle has a lowered pKa value, thus bringing the maximum activity 4-1BB Inhibitor Accession closer to physiological pH.…
Ein IL-3 Species expression was evident when it was ectopically expressed (Figures 2BEin expression was evident when it was ectopically expressed (Figures 2B, lane three versus four), implying that the…
E to recovery of motor block wererecorded.Timetorecoveryofmotorblockwasdefinedasthe time interval amongstE to recovery of motor block wererecorded.Timetorecoveryofmotorblockwasdefinedasthe time interval among intrathecal injection and free of charge movement with the lowerextremities.Firstanalgesicrequest,whichwasrecordedasthe primaryoutcome,wasdefinedasthetimeperiodbetweenintrathecal…
Ceptor transducing gene GNAT1, the short wave cone opsin OPN1SWCeptor transducing gene GNAT1, the short wave cone opsin OPN1SW, as well as the homeogene CRX 9 (Figure 2). The induction…
Nnel, when coexpressed in oocytes at sufficiently high local concentrations (Maltez et al., 2005; Opatowsky et al., 2004; Van Petegem et al., 2008). Therefore we expected that on coexpression with…
Sign of reciprocal DMXAA derivatives ought to cause the development of human-active STING agonists for antitumor, antiviral, and vaccine adjuvant applications.Author Manuscript Author Manuscript Author Manuscript Author ManuscriptEXPERIMENTAL PROCEDURESCrystallization and…
Haracterized degradative pathways that appear to turn into active when GAGs levels are elevated. Di-, tri-,Mol Genet Metab. Author manuscript; offered in PMC 2015 February 01.Lawrence et al.Pagetetra-, and penta-,…
D transfusion has been broadly debated and transfusion practices nevertheless remainD transfusion has been broadly debated and transfusion practices still stay very variable and controversial. We've got previously reported the…
For the purification of final dendrimer compound is just not easy for the reason thatFor the purification of final dendrimer compound is just not easy simply because other solutions normally…
Human E-box 1 (five CAATGAAGAAAAATC CAGCTAGCCCTTCCAAGGGGA), wild-type human E-box 2 (five CCTAGCCCCCAGCTTCACCTGGGCCCCTCCCGGGTC), and Mutated human E-box 2 (5 CCTAGCCCCCAGCGGT ACCTGGGCCCCTCCCGGGTC).CHROMATIN IMMUNOPRECIPITATION (ChIP)components (HREs). Two such web sites had been identified,…
He capacity for multi-lineage differentiation and powerful myelopoiesis. In 2005, a novel activating mutation involving the Janus kinase 2 gene (JAK2), which resulted in expression with the V617F activated mutant,…
Omal/stem cells (MSCs) would outcome inside a "humanized" sheep HSC niche. MSCs are recognized to market HSC engraftment and immune recovery after HSC transplantation, likely by means of the provision…
MM tion with PGA.15 DsPME drastically enhanced the clarification NaCl. ElutedMM tion with PGA.15 DsPME drastically enhanced the clarification NaCl. Eluted fractions had been once again analyzed for PME CA…
Omide. In October 2009, therapy with adalimumab was suspended resulting from respiratoryOmide. In October 2009, therapy with adalimumab was suspended as a consequence of respiratory difficulty and urticarial rush 5-HT7…
Ectopic expression of CRBN would have an effect on the signal pathway in the opposite manner. In addition, we also wondered how the human mutation linked to mild mental deficit…
Scorbic acid biphosphate and 10 mM beta-glycerophosphate (25). A single flask was cultured in mere DMEM supplemented with 5 FBS and 1 P/S because the manage group. Right after 21-day…
Etry information showed no induction of either apoptosis or necrotherapeutics that typically show great pharmacokinetics and sis at concentrations as much as six.25 g/mL 2C7 scFv. Thus, this biodistribution. Also,…
Counts for up to 75 of RelB custom synthesis mortality within this popula-tion . The relationCounts for up to 75 of mortality within this popula-tion . The relation between adiposity…
For The Trauma and Orthopedics Study Division. AEH can be a boardFor The Trauma and Orthopedics Study Division. AEH is usually a board certified Anesthesiologist as well as the Chief…
Serum levels of CoQ10 16 to 54 , mostly because of this of minimizing serum LDL, which can be its key transporter . The effects of statins on skeletal muscle…
He National Cancer Institute, the National Institutes of Overall health, the American Cancer Society, the Division of Defense, or Susan G. Komen for the Remedy. We would like to thank…
Tracellular compartments. For this reason, it is actually the key biomarker at presentTracellular compartments. For this reason, it is actually the primary biomarker currently made use of for early diagnosis…
Re there was reduction of 44 in invasive breast cancers (Po0 ?0001) in addition to a important reduction in DCIS (P ?0.009). While tamoxifen is given for 5 years, follow-up…
S are expressed relative for the control ApoE-null mice. (a) iNOS expression by real-time PCR indicates a 4-fold excess in manage ApoE-null versus DKO ( 0.05) plus a tenfold distinction…
L tract with this dye motivated us to investigate the staining patterns at GlyT1 Inhibitor Formulation various developmental stages. DCFH-DA labeled the fertilized egg from even the a single cell…
Xpression index for ELF97DNA ratio. E Interaction OX1 Receptor custom synthesis effects plot showingXpression index for ELF97DNA ratio. E Interaction effects plot displaying effects of 2 combined aspects on ELF97DNA…
Nhibitor epigallocatechin gallate was added. Fluorescence was reverse, TGAGGTCACCTTTGGTGTCA; Litaf forwardNhibitor epigallocatechin gallate was added. Fluorescence was reverse, TGAGGTCACCTTTGGTGTCA; Litaf forward, CTCCAGGACCT- measured using a Wallac ARVO V (PerkinElmer), and…
Tis in mice, which could be Dopamine β-hydroxylase review inhibited by co-transfer of IL17. CECs had been collected from untreated mice (control CECs) or from mice with TNBS-induced colitis on…
L symptoms might differ among OXPHOS defects, however the most affected organs are often these with higher energy expenditure, including brain, skeletal muscle, and heart . Patients with OXPHOS defects…
Esponse to endotoxin . TNF-a is secreted by many different cells, like hepatocytes, kupffer cells mast cells and epidermal cells. Nevertheless, primarily activating macrophages and natural killer cells, releasePLOS One…
Cterized by NMR spectroscopy. The proton spectrum displayed a single setCterized by NMR spectroscopy. The proton spectrum displayed a single set of resonances for the tripyrrolic ligand, constant PRMT8 Molecular…
For The Trauma and Orthopedics Research Department. AEH is actually a boardFor The Trauma and Orthopedics Research Department. AEH is a board certified Anesthesiologist as well as the Chief of…
A stronger sensation (Fig. 1A, bars, n=30), and assigning higher intensity ratings to that side (Fig. 1A, ?. However, by the third application, subjects no longer reliably chose the treated…
D Schuell) by electrotransfer for 90 min RNA was mixed with primers and dNTPs, denatured by heat- at 400 mA. The membrane was washed for 1 h in PBS/milk/ ing…
Ile includes a lowered pKa worth, therefore bringing the maximum activityIle includes a lowered pKa worth, therefore bringing the maximum activity closer to physiological pH. Having said that, Mancin and…
Follicles (IL-2 drug Figure S3). The far more serious arrest in Crect; RR; WlsFollicles (Figure S3). The far more serious arrest in Crect; RR; Wls flfl mutants (Figure two) recommended…
The combination). These benefits suggest that combined VPAdasatinib remedy increases the expression of inhibitory proteins p21Cip1 and p27Kip1 in HL60 cells, consequently maintaining those cells in the G1 phase (Fig.…
New subproject in glycomics, which can be suggestively named marine medicinal glycomics. The objective of this subproject within the presently ongoing glycomic era is not limited to dissemination of information…
Y was employed. Here, we briefly describe the ENDOR spectra anticipatedY was utilised. Right here, we briefly describe the ENDOR spectra expected for 14N ligands in Cu(II) complexes beneath our…
Vidual sterile capped tubes containing phosphate buffered saline (PBS) until use.Vidual sterile capped tubes containing phosphate buffered saline (PBS) until use.Scanning electron microscope (SEM) analysisFresh human entire bloodFresh human whole…
Els rebounded through kind I IFN neutralization at 48 hours post-infection (Figure 4A, suitable panel). This rebound was not observed in other PHH preparations (See Figure 4E below). Neutralization of…
S are infections in the periodontium creating complicated inflammatory, enzymatic andS are infections from the periodontium producing Nav1.8 review complex inflammatory, enzymatic and also other biologic influences that cause physical…
Imilar numbers of cells in each and every domain have been analyzed involving 4Imilar numbers of cells in every domain had been analyzed among 4 controls and mutants. Statistical significance…
Ontrasting with studies of protein kinase C catalytic domain swaps, which reconstituted functional enzymes with altered specificity (Walker et al. 1995). In that case, the degree of conservation was a…
Lot evaluation and behavioural analyses. Values of P 0.05 have been regarded important. Image J computer software was applied to measure pixel density for western blot analysis.3.1 Results3.1.1 Impact of…
From samples with filter paper placed on glass microscope slides, andFrom samples with filter paper placed on glass microscope slides, and covered with a second slide. The sandwich of two…
Itary Health-related University. Prior to specimen Thymidylate Synthase MedChemExpress collection, sufferers signed informed consent types. Regular gastric mucosal biopsy specimens had been collected for the duration of gastroscopy. Gastric cancer…
Sured. This study was approved by the University of Florida Institutional Overview Board (UFIRB), and all procedures on human subjects were carried out in accordance together with the Helsinki Declaration…
Fbinduction by Tgfb. Second, Cebpb binding for the Arf promoter isFbinduction by Tgfb. Second, Cebpb binding for the Arf promoter is diminished by Tgfb treatment within a time frame coincident…
MM tion with PGA.15 DsPME considerably enhanced the clarification NaCl. ElutedMM tion with PGA.15 DsPME significantly enhanced the clarification NaCl. Eluted fractions had been once more analyzed for PME JAK…
O respond to TAM. Chrisholm et al. also showed cytotoxic effects of EGCG alone in yet another ER-negative breast cancer cell line, Hs578T as well as a synergistic cytotoxic impact…
D protective at the least initially, because it aims at promoting healingD protective a minimum of initially, because it aims at promoting healing of broken tissues. However, the exaggerated and…
Ein expression was evident when it was ectopically expressed (COX-2 Compound Figures 2BEin expression was evident when it was ectopically expressed (Figures 2B, lane 3 versus four), implying that the…
How promise as anti-cancer therapies, our information recommend that bacterial CCR8 Formulation siderophores act as cytotoxins in the course of infection. Clinical isolates of K. pneumoniae produce 50 to 100…
Ding Jak-Stat signaling pathway has been well characterized in different biological processes and illness models such as DS but data pertaining towards the part of this pathway within the improvement…
By utilizing the Pearson product moment correlation coefficient test. Stepwise severalBy utilizing the Pearson solution moment correlation coefficient test. Stepwise many linear P2Y6 Receptor web regression analysis was performed to…
MM tion with PGA.15 DsPME substantially enhanced the clarification NaCl. ElutedMM tion with PGA.15 DsPME drastically enhanced the clarification NaCl. Eluted fractions had been once more analyzed for PME activity…
Olate. Eating two garlic cloves a day could marginally decrease blood cholesterol levels. Consumption of 5 eggs per week will not drastically raise CVD threat in healthier men and women.…
Lished database with coral genome (Acropora digitifera, see ). The matched coral proteins have been then blasted NCBI database to finalize the identification (see the procedure described inside the ``Materials…
MM tion with PGA.15 DsPME drastically enhanced the clarification NaCl. ElutedMM tion with PGA.15 DsPME significantly enhanced the clarification NaCl. Eluted fractions were again analyzed for PME activity by of…
Ored for many years at -80 and would be employed for additionalOred for many years at -80 and could be applied for additional studies as novel genomics technologies emerge. The…
D 12?five different multimer reporters. Multimer labeling requires the usage of one particular optical channel for every peptide epitope, as well as the optical spillover from one particular fluorescent dye…
Hnology (Santa Cruz, CA). Anti-EZH2 (AC22) antibodies: Cell Signaling Technology (Boston, MA). Anti-osteopontin (O-17) antibody: ImmunoBiological Laboratories Co., Ltd. (Gunma, Japan). Plastic dishes: IWAKI (Chiba, Japan).Cell differentiation assaysFor osteoclastic differentiation,…
Uman tumors, within a substantial number the gene is intact butUman tumors, within a substantial number the gene is intact but silenced alone or collectively with INK4A . Thus, understanding…
Mined working with a microbalance (Mettler Toledo XP2U; 0.1 g).Aliquots ofMined employing a microbalance (Mettler Toledo XP2U; 0.1 g).Aliquots of food suspensions were filtered onto precombusted glass fibre filters (Whatman…
Of plasmid produced at the laboratory scale. The two stage course of action entails (i) growth and then (ii) definitely constant volume-fed batchlike production. As reported elsewhere (18), we discovered…
Injury across IT or IV exposure routes. Female rats also suffered myocardial infarct expansions following I/R in each C60 P/Q-type calcium channel Antagonist Compound exposed groups compared with infarct sizes…
Host was affected by food MNK1 manufacturer excellent (factor "food"; per person: FHost was PARP3 drug impacted by food good quality (aspect "food"; per individual: F5, 54 = six.18, p…
Te early surface ectoderm and mesenchyme, and an inability to circumventTe early surface ectoderm and mesenchyme, and an inability to circumvent the intrinsic redundancy of Wnt ligands. We took a…
Ipheral blood mononuclear cells (PBMCs) derived from the patient had been thawed in the similar time, and viability was confirmed as 90 . PBMCs (five?05/mL) have been cultured with 10…
Nt Scpep1 (26), respectively, were incubated overnight at four with goat-MRP46 and goatMRP300 immobilized on a 2-ml Affi-Gel 10 matrix (Bio-Rad). Washing with glucose-6-phosphate and elution with mannose 6-phosphate have…
E present enhance in response to an increase in rotation rateE present improve in response to an increase in rotation rate for the biofilm decreased because the rotation rate was…
Tors was intact without having ectopic Sox9 expression, but showed diminished expressionTors was intact with no ectopic Sox9 expression, but showed diminished expression in the skeletal differentiation marker, Osx and…
Sized that, if leptin enhances a female's perception of her energy levels (e.g., by way of effects on appetite or perceived physique situation), exogenous leptin should lessen preferences for heterospecifics…
Ifferent research that showed impaired adult neurogenesis inside the subventricular zone (SVZ) and impaired embryonicLing et al. BMC Genomics 2014, 15:624 biomedcentral/1471-2164/15/Page 3 ofneurogenesis in Ts1Cje neocortices . The Ts1Cje…
T immunofluorescence with DAPI stained nuclei (A ). Boxed locations correspond toT immunofluorescence with DAPI stained nuclei (A ). Boxed locations correspond to higher magnification panels (A9 9). (EPS)AcknowledgmentsWe thank…
Al shapes, reduced agglomeration tendency and higher fine particle fraction (FPF) . Spray drying is an attractive solidification approach in the field of respiratory drug delivery, with respect to its…
Ycotic, 10 mM HEPES, 20 ng/mL basic FGF, and 20 ng/mL EGF (R D Systems) based on a prior procedure.16 Neurospheres have been dissociated to single cells with accutase and…
Lding blocks, CH CH OH HO respectively. Linear-dendritic copolymer was preparedLding blocks, CH CH OH HO respectively. Linear-dendritic copolymer was prepared G3-(COOH) in the presence of DCC in pyridine. Transmission…
T immunofluorescence with DAPI stained nuclei (A ). Boxed areas correspond toT immunofluorescence with DAPI stained nuclei (A ). Boxed places correspond to high magnification panels (A9 9). (EPS)AcknowledgmentsWe thank…
Ntained synaptic function . Growing SIRT1 levels or activating SIRT1 pharmacologically with NAD ?in vitro has also be shown to increase -secretase activity and decrease -amyloid deposition in primary neuronal…
And treated them with LL-IL-27 when enterocolitis was established. All mice had succumbed to illness by ten.five weeks following transfer; thus IL-10 is required for LL-IL-IL-27's therapeutic impact (Fig. 5A).…
Sial layers in the dorsal fillets. A) Difficult muscles show aSial layers of the dorsal fillets. A) Tough muscles show a fine line of Col I among two adjacent cells…
Kable IP list reduce in -amylase activity following 50 min incubation. The boost inKable reduce in -amylase activity Dopamine Receptor custom synthesis immediately after 50 min incubation. The raise in…
S a crucial focus with the synthetic community. Our lab has a longstanding interest in the catalytic asymmetric synthesis of such moieties (Scheme 1). In 2006, our lab reported the…
Iposomes had been ready working with a modified version of the protocol previouslyIposomes were prepared applying a modified version in the protocol previously reported.18 A suspension of POPCErgAmB in 1:1…